Ceramic – High Power OCU-440 UE400 Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 12 mm blister tape, cathode to transporting perforation all devices sorted into luminous intensity classes taping: face-up (T) Merkmale: Größe: 3,8 x 3,8 x 1,0 mm Gehäusematerial: AlN Keramik Bauteile sind ROHS und REACH konform Bleifrei lötbar, Lötpads: versilbert Gegurtet in 12 mm Blistergurt, Kathode zur Transportperforation Alle Bauteile in Intensitätsklassen sortiert Gurtung: Face-up (T) Electro-Optical Characteristics (T=25°C) Elektrooptische Eigenschaften Parameter Emitting Color Farbe Forward Voltage Flussspannung Peak Wavelength Peak Wellenlänge FWHM Halbwertsbreite Radiant Intensity Strahlstärke Reverse Current (1) Sperrstrom (1) Symbol Condition Uf If = 350 mA λP If = 350 mA Δλ If = 350 mA Ie If = 350 mA IR UR = 5V Min Typ ultraviolet ultraviolett 3,20 400 Max Unit 3,60 V 405 nm 15 nm 70 110 mW/sr - - - μA LED should never be operated with reverse bias LED sollt niemals mit Sperrspannung betrieben werden Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 3/14 Page/Seite 1/8 Ceramic – High Power OCU-440 UE400 Maximum Ratings Grenzwerte Parameter Forward Current Flussstrom Forward Current, pulsed Flussstrom, gepulst Reverse Voltage(1) Sperrspannung Thermal Resistance Wärmewiderstand Operating Temperatur Betriebstemperatur Storage Temperature Lagertemperatur Symbol tp≤100μs, =1:10 Electrostatic discharge classification (MIL-STD-883) Elektrostatische Empfindlichkeit Outline Drawing Zeichnung Min Max Unit If, max 350 mA If, pulse 800 mA UR - V Rth_JA 10 K/W Top -40 +85 °C TSt -40 +100 °C class 1 Recommended Soldering Pad Empfohlenes Lötpad 1.0 3.5 1.7 3.8 1.6 3.8 3.5 Marking at cathode Markierung an der Kathode Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 3/14 Page/Seite 2/8 Ceramic – High Power OCU-440 UE400 Performace Diagram Kennlinien 1,0 0,8 rel. Intensity [a.u.] Forward Current [mA] 100 10 1 0,1 0,6 0,4 0,2 0,0 0,01 2,00 2,20 2,40 2,60 2,80 3,00 Forward Voltage [V] 3,20 0 3,40 Forward Current vs. Forward Voltage Flussstrom über Flussspannung 50 100 150 200 250 Forward Current [mA] 300 350 400 300 350 400 Intensity vs. Forward Current Strahlstärke über Flussstrom 400 406,0 350 Peak Wavelength [nm] 300 IF [mA] 250 200 150 100 404,0 403,0 402,0 50 0 405,0 -40 -20 0 20 40 60 80 401,0 100 0 Top[°C] Maximum Forward Current vs. Ambient Temprature Max. Flussstom über Umgebungstemperatur 50 100 150 200 250 Forward Current [mA] Forward Current vs. Shift Peak Wavelength Flussstrom gegen Verschiebung der Wellenlänge 1,0 90 rel. Intensity [a.u.] 0,8 120 1,0 60 0,6 150 0,4 30 0,5 0,2 0,0 0,0 300 320 340 360 380 400 420 Wavelength [nm] 440 460 480 180 0 500 Spectrum @ 350mA Spektrum Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved View Angle Abstahlung www.osa-opto.com edition 3/14 Page/Seite 3/8 Ceramic – High Power OCU-440 UE400 Soldering Conditions Lötprofile 300 10...20s Temperature [°C] 250 230°C IR reflow soldering profile for lead containig solder 200 170°C 150 120°C 40s max. 100 IR reflow Lötprozess für bleihatiges Lot 3K/s max. 50 4K/s max 0 50 100 150 Time [s] 200 250 300 300 217°C 3K/s max Temperature [°C] 250°C 245°C 250 200 180°C IR reflow soldering profile for lead free soldering 10...20s 60s max 150 120s max 100 IR Reflow Lötprozess für bleifreies Lot 4K/s max 50 3K/s max 0 50 100 150 Time [s] 200 250 300 Recommended profile for OCU-440 Empfohlenes Lötprofil für OCU-440 170°C max IR reflow soldering profile for low temperature solder Preheat 120s 60s max 4K/s max 3K/s max IR Reflow Lötprozess für Niedrigtemperaturlot Recommended solder: Empfohlenes Lot: Sn42Bi52 Manual Soldering: Manuelles Löten: max power of iron 25W / 300°C for 3s Max. Leistung des Lötkolben 25W / 300°C für 3s Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 3/14 Page/Seite 4/8 Ceramic – High Power OCU-440 UE400 Ordering Code For Parts Kodierung der Bestellnummer Series Serie Color Farbe OCU-440 - Encapsulation Verguss ??????? - ? - Packaging Verpackung ? T X Type definition, e.g. Typenbezeichnung z.B. – taped up – uncolored clear OCU-440 UE400-X-T Tape And Reel Packing Gurt und Spule D 7’’ Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved Parts/reel 2000 www.osa-opto.com edition 3/14 Page/Seite 5/8 Ceramic – High Power OCU-440 UE400 Packing Verpackung The reel is sealed in special plastic bag with integrate ESD protection ( MIL - STD 81705 ) including a silica dry-pack. MSL level acc. to IPC/JEDEC J-STD 020D: Level 2 for Europe Level 2a for all other countries Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem HighshieldAntistatic-Beutel verschweißt. Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D: Schwellwert 2 für Europa Schwellwert 2a für alle anderen Länder Label Etikett Order No. Bestellnr. XXXXXXXXXX Type Typ ???-??? ???-?-? Intensity group Intensitätskgruppe ZZ Charge No. Chargennr. 1122-AAAAAA Quantity Anzahl 9999 Customer order No. Kundenspezifische Nr. Color Class: CC Color Class optional Farbklasse optional LED Radiant Intensity Groups And Subgroups [mW/sr] Strahlstärkeklassen und Unterklassen (general information – not this device specific; Allgemeine informationen – nicht bauteilspezifisch) N: P: Q: R: 28 45 71 112 - 45 71 112 180 N1: 28.0 - 35.5 N2: 35.5 - 45.0 P1: 45 - 56 P2: 56 - 71 Q1 : 71 - 90 Q2 : 90 - 112 R1 : 112 - 140 R2 : 140 - 180 Measured according to CIE 127. All SMD-LEDs are 100% measured and selected on full automated equipment with an accuracy of ± 11 %. Special service: Brightness selection in sub selections possible. Color selection in 3 sub selections possible (each subgroup per reel). Gemessen nach CIE127. Alle SMD-LEDs sind 100% gemessen und auf automatischen Anlagen mit einer Toleranz von ±11% selektiert. Spezieller Service: Selektion der Helligkeit in Unterklassen auf Anfrage möglich. Farbselektion in drei Unterklassen möglich (je eine Unterklasse pro Spule) Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 3/14 Page/Seite 6/8 Ceramic – High Power OCU-440 UE400 Warnings and Handling Instructions Sicherheitshinweise UV LEDs emit intense but mainly invisible ultraviolet radiation when in operation, which may be harmful to eyes, even for brief periods. * DO NOT LOOK DIRECTLY INTO THE UV LED DURING OPERATION * * BE SURE THAT YOU AND ALL PERSONS IN THE VICINITY WEAR SAFETY GOGGLES THAT PROVIDE SUITABLE UV PROTECTION WHEN A UV LED IS OPERATING * * KEEP CHILDREN AWAY FROM THE OPERATING VICINITY * * KEEP UV LEDs OUT OF THE REACH OF CHILDREN * If you incorporate a UV LED into a product, be sure to provide appropriate cautionary labels and instructions. Please follow all standard procedures for storing, handling, cleaning, mounting, soldering, disposal, or otherwise handling LED dies or packaged LEDs, including static electricity protection. The user has the responsibility to inform, train and instruct customers and co-workers UV-LEDs are ESD sensitive (Class1). The handling and usage have to consider this device property UV-LEDs emittieren im Betrieb intensive, aber unsichtbare Strahlung, welche auch bei kurzer Bestrahlung für die Augen gefährlich sein kann. *IM BETRIEB NICH DIREKT IN DIE UV-LED SEHEN* * DAS BEDIENPERSONAL UND ALLE PERSONEN IM ARBEITSBEREICH MÜSSEN GEEIGNETE SCHUTZBRILLEN TRAGEN; WENNDIE UV-LED IN BETRIEB IST* *KINDER VOM ARBEITSBEREICH FERN HALTEN* *UV-LEDS AUSERHALB DER REICHWEITE VON KINDERN AUFBEWAHREN* Wenn UV-LEDs in ein Gerät eingebaut werden, dann sind die notwendigen Sicherheitshinweise und Warmzeichen anzubringen. UV-LEDs sind ESD-empfindlich (Klasse 1). Die Handhabung und Nutzung ist dieser Bauteileigenschaft anzupassen. Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 3/14 Page/Seite 7/8 Ceramic – High Power OCU-440 UE400 Attention please The information describes the type of component and shall not consider as assured characteristics. Terms of delivery and rights to change reserved. The data sheet may change without prior information; the valid issue will be on our webpage in internet. Due to technical requirements components may contain dangerous substances. Parameters can vary in different applications. All operating parameters must be validated for each customer application by the customer. OSA opto light GmbH does not have the responsibility for the reliability and the degradation behaviour of products made with OSA opto light GmbH diodes because they depend not only on the diode but also on the conditions of manufacture or design of the final products. The customer is responsible to approve the long term stability of the product according to customer’s requirements. Components used in toys, life support devices or systems or safety devices or systems must be expressly authorized by OSA opto light GmbH for such purpose! Packaging: OSA opto light GmbH uses recyclable packages, please use the recycling operators known to you. Zur Beachtung Dieses Datenblatt beschreibt typische, nicht uneingeschränkt garantierte Bauelementeigenschaften. Es gelten die AGB der OSA opto light GmbH, das Recht zur Änderung dieser ist vorbehalten. Änderungen im Sinne des technische Fortschritts vorbehalten, eine automatische Information erfolgt nicht. Die jeweils gültige Version ist auf unserer Internet- Seite vorhanden. Auf Grund technischer Erfordernisse können die Bauelemente gefährliche Substanzen enthalten. Produkteigenschaften können je nach Anwendung variieren. Die Produkteigenschaften müssen in der Anwendung durch den Kunden geprüft werden. Die OSA opto light GmbH ist nicht für die Zuverlässigkeit und das Alterungsverhalten von Produkten, die unter Verwendung von von der OSA opto light GmbH hergestellten Dioden gefertigt wurden, verantwortlich, da Beides nicht nur von den Dioden selbst, sondern auch von Konstruktion und Fertigung des Endproduktes abhängt. Der Kunde ist verpflichtet, das Langzeitverhalten des Produktes gemäß seiner Anforderungen zu prüfen und freizugeben. Werden die Dioden in Spielzeug, lebenserhaltenden oder sicherheitsrelevanten Systemen und Geräten eingesetzt, muss dies durch die OSA opto light GmbH ausdrücklich gestattest werden. Rückgabe von Verpackungsmaterial: Die OSA opto light GmbH verwendet wiederverwertbare Verpackung, bitte wenden Sie sich an einen örtlichen Verwerter. OSA Opto Light GmbH www.osa-opto.com Köpenicker Str.325 / Haus 201 12555 Berlin Germany Tel. +49 (0)30 65762683 [email protected] Copyright © 2014 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 3/14 Page/Seite 8/8