High Power - Ceramics OCI-440 MUR Features: size 3,8(L) x 3,8(W) x 1,0(H) mm circuit substrate: AlN Ceramics devices are ROHS and REACH conform lead free solderable, soldering pads: silver plated taped in 16 mm blister tape, cathode to transporting perforation all devices sorted into radiant intensity classes taping: face-up (T) Merkmale: Größe: 3,8 x 3,8 x 1,0 mm Gehäusematerial: AlN Keramik Bauteile sind ROHS und REACH konform Bleifrei lötbar, Lötpads: versilbert Gegurtet in 16 mm Blistergurt, Kathode zur Transportperforation Alle Bauteile in Intensitätsklassen sortiert Gurtung: Face-up (T) Electro-Optical Characteristics (T=25°C) Elektrooptische Eigenschaften Parameter Emitting Color Farbe Forward Voltage Flussspannung Peak Wavelength Peak Wellenlänge Dominant Wavelength (1) Dominante Wellenlänge FWHM Halbwertsbreite Radiant Intensity Strahlstärke Luminous Intensity (1) Lichtstärke Radiant Flux (1) Strahlungsleistung Reverse Current Sperrstrom (1) Symbol Condition Min Typ Max Unit red rot Uf If = 350 mA λP If = 350 mA λD If = 350 mA 640 nm Δλ If = 350 mA 25 nm Ie If = 350 mA 110 mW/sr Iv If = 350 mA 7500 mcd e If = 350 mA IR UR = 5V 650 45 2.30 3.00 V 660 670 nm 145 mW 100 μA For information only Nur zur Infomation Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 10/16 Page/Seite 1/7 High Power - Ceramics OCI-440 MUR Maximum Ratings Grenzwerte Parameter Forward Current Flussstrom Forward Current, pulsed Flussstrom, gepulst Reverse Voltage Sperrspannung Thermal Resistance Wärmewiderstand Operating Temperature Betriebstemperatur Storage Temperature Lagertemperatur Symbol tp≤100μs, =1:10 Min Max Unit If, max 500 mA If, pulse 700 mA UR 5 V Rth JA 10 K/W Top -40 +85 °C TSt -40 +85 °C Outline Drawing Zeichnung Recommended Soldering Pad Empfohlenes Lötpad 1.0 3.5 1.7 3.8 1.6 3.8 3.5 Marking at cathode Markierung an der Kathode Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 10/16 Page/Seite 2/7 High Power - Ceramics OCI-440 MUR Performance Diagram Kennlinien 1000 1,2 1,0 Forward Current [mA] 100 0,8 rel. Intensity 10 1 0,6 0,4 0,1 0,2 0,0 0,01 1 1,2 1,4 1,6 1,8 Forward Voltage [V] 2 2,2 0 2,4 Forward Current vs. Forward Voltage Flussstrom über Flussspannung 50 100 150 200 250 Forward Current [mA] 300 350 400 Intensity vs. Forward Current Strahlstärke über Flussstrom 661,0 600 660,5 Peak Wavelength [nm] 500 IF [mA] 400 300 200 100 0 660,0 659,5 659,0 658,5 -40 -20 0 20 40 60 80 658,0 100 0 Top[°C] Max. Forward Current vs. Ambient Temperature Max. Flussstrom über Umgebungstemperatur 50 100 150 200 250 300 Forward Current [mA] 350 400 450 Forward Current vs. Shift Peak Wavelength Flussstrom gegen Verschiebung der Wellenlänge 1,0 90 rel. Intensity [a.u.] 0,8 120 1,0 60 0,6 150 0,4 30 0,5 0,2 0,0 0,0 500 550 600 650 Wavelength [nm] 700 750 180 0 800 Spectrum Spektrum Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved View Angle Abstrahlung www.osa-opto.com edition 10/16 Page/Seite 3/7 High Power - Ceramics OCI-440 MUR Soldering Conditions Lötprofile 300 10...20s Temperature [°C] 250 230°C IR reflow soldering profile for lead containing solder 200 170°C 150 120°C 40s max. 100 IR Reflow Lötprozess für bleihaltiges Lot 3K/s max. 50 4K/s max 0 50 100 150 Time [s] 200 250 300 300 217°C 3K/s max Temperature [°C] 250°C 245°C 250 200 IR reflow soldering profile for lead free soldering 10...20s 180°C 60s max 150 120s max 100 IR Reflow Lötprozess für bleifreies Lot 4K/s max 50 3K/s max 0 50 100 150 Time [s] 200 250 300 Recommended profile for OCL-440 Empfohlenes Lötprofil für OCL-440 IR reflow soldering profile for low temperature solder 200 Temperature [°C] 150 Preheat 120 s 60 s max. IR Reflow Lötprozess für Niedrigtemperaturlot 100 4 K/s max. 3 K/s max. Recommended solder: Empfohlenes Lot: Sn42Bi52 50 0 50 100 150 200 250 Time [s] Manual Soldering: Manuelles Löten: max power of iron 25W / 300°C for 3s Max. Leistung des Lötkolben 25W / 300°C für 3s Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 10/16 Page/Seite 4/7 High Power - Ceramics OCI-440 MUR Ordering Code For Parts Kodierung der Bestellnummer Series Serie Color Farbe OCI-440 - Encapsulation Verguss ??????? - ? - Packaging Verpackung ? T X Type definition, e.g. Typenbezeichnung z.B. – taped up – uncolored clear OCI-440 MUR –X-T Tape And Reel Packing Gurt und Spule D 7’’ Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved Parts/reel 1000 www.osa-opto.com edition 10/16 Page/Seite 5/7 High Power - Ceramics OCI-440 MUR Packing Verpackung The reel is sealed in special plastic bag with integrate ESD protection ( MIL - STD 81705 ) including a silica dry-pack. MSL level acc. to IPC/JEDEC J-STD 020D: Level 2 for Europe Level 2a for all other countries Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem HighshieldAntistatic-Beutel verschweißt. Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D: Schwellwert 2 für Europa Schwellwert 2a für alle anderen Länder Label Etikett Order No. Bestellnr. XXXXXXXXXX Type Typ ???-??? ???-?-? Intensity group Intensitätsgruppe ZZ Charge No. Chargennr. 1122-AAAAAA Quantity Anzahl 9999 Customer order No. Kundenspezifische Nr. Color Class: CC Color Class optional Farbklasse optional LED Radiant Intensity Groups And Subgroups [mW/sr] Strahlstärkeklassen und Unterklassen (general information – not this device specific; Allgemeine Informationen – nicht bauteilspezifisch) P: Q: R: 45 71 112 - 71 112 180 P1: 45 - 56 P2: 56 - 71 Q1 : 71 - 90 Q2 : 90 - 112 R1 : 112 - 140 R2 : 140 - 180 Measured according to CIE 127. All SMD-LEDs are 100% measured and selected on full automated equipment with an accuracy of ± 11 %. Special service: Brightness selection in sub selections possible. Color selection in 3 sub selections possible (each subgroup per reel). Gemessen nach CIE127. Alle SMD-LEDs sind 100% gemessen und auf automatischen Anlagen mit einer Toleranz von ±11% selektiert. Spezieller Service: Selektion der Helligkeit in Unterklassen auf Anfrage möglich. Farbselektion in drei Unterklassen möglich (je eine Unterklasse pro Spule) Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 10/16 Page/Seite 6/7 High Power - Ceramics OCI-440 MUR Attention please The information describes the type of component and shall not consider as assured characteristics. Terms of delivery and rights to change reserved. The data sheet may change without prior information; the valid issue will be on our webpage in internet. Due to technical requirements components may contain dangerous substances. Parameters can vary in different applications. All operating parameters must be validated for each customer application by the customer. OSA opto light GmbH does not have the responsibility for the reliability and the degradation behavior of products made with OSA opto light GmbH diodes because they depend not only on the diode but also on the conditions of manufacture or design of the final products. The customer is responsible to approve the long term stability of the product according to customer’s requirements. Components used in toys, life support devices or systems or safety devices or systems must be expressly authorized by OSA opto light GmbH for such purpose! Packaging: OSA opto light GmbH uses recyclable packages, please use the recycling operators known to you. Zur Beachtung Dieses Datenblatt beschreibt typische, nicht uneingeschränkt garantierte Bauelementeigenschaften. Es gelten die AGB der OSA opto light GmbH, das Recht zur Änderung dieser ist vorbehalten. Änderungen im Sinne des technische Fortschritts vorbehalten, eine automatische Information erfolgt nicht. Die jeweils gültige Version ist auf unserer Internet- Seite vorhanden. Auf Grund technischer Erfordernisse können die Bauelemente gefährliche Substanzen enthalten. Produkteigenschaften können je nach Anwendung variieren. Die Produkteigenschaften müssen in der Anwendung durch den Kunden geprüft werden. Die OSA opto light GmbH ist nicht für die Zuverlässigkeit und das Alterungsverhalten von Produkten, die unter Verwendung von der OSA opto light GmbH hergestellten Dioden gefertigt wurden, verantwortlich, da Beides nicht nur von den Dioden selbst, sondern auch von Konstruktion und Fertigung des Endproduktes abhängt. Der Kunde ist verpflichtet, das Langzeitverhalten des Produktes gemäß seiner Anforderungen zu prüfen und freizugeben. Werden die Dioden in Spielzeug, lebenserhaltenden oder sicherheitsrelevanten Systemen und Geräten eingesetzt, muss dies durch die OSA opto light GmbH ausdrücklich gestattest werden. Rückgabe von Verpackungsmaterial: Die OSA opto light GmbH verwendet wiederverwertbare Verpackung, bitte wenden Sie sich an einen örtlichen Verwerter. OSA Opto Light GmbH www.osa-opto.com Köpenicker Str.325 / Haus 201 12555 Berlin Germany Tel. +49 (0)30 65762683 [email protected] Copyright © 2016 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com edition 10/16 Page/Seite 7/7