1206 Standard OLS-150 MUR Features: • size 1206: 3.2(L) x 1.6(W) x 1.2(H) mm • circuit substrate: glass laminated epoxy • devices are ROHS and REACH conform • lead free solderable, soldering pads: gold plated • taped in 8 mm blister tape, cathode to transporting perforation • all devices sorted into luminous intensity classes • taping: face-up (T) or face-down (TD) possible Merkmale: • Größe: 3,2 x 1,6 x 1,2 mm • Trägerstreifen: Glasfaserlaminat • Bauteile sind ROHS und REACH konform • Bleifrei lötbar, Lötpads: vergoldet • Gegurtet in 8mm Blistergurt, Kathode zur Transportperforation • Alle Bauteile in Intensitätsklassen sortiert • Gurtung: Face-up (T) und Face-down (TD) möglich • Electro-Optical Characteristics (T=25°C) Elektrooptische Eigenschaften Parameter Emitting Color Farbe Forward Voltage Flussspannung Peak Wavelength Peak Wellenlänge FWHM Halbwertsbreite Radiant Intensity Strahlstärke Luminous Intensity(1) Lichtstärke Reverse Current (1) Sperrstrom (1) Symbol Condition Min Typ Max Unit red rot M Uf If = 20 mA λP If = 20 mA ∆λ If = 20 mA Ie If = 20mA Iv If = 20 mA IR UR = 5V 650 1.80 2.10 2.50 V 660 670 nm 20 nm 2.25 mW/sr 150 mcd 100 µA Only for information Nur zur Information Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com preliminary edition 3/13 Page/Seite 1/7 1206 Standard OLS-150 MUR • Maximum Ratings Grenzwerte Parameter Forward Current Flussstrom Forward Current, pulsed Flussstrom, gepulst Reverse Voltage Sperrspannung Thermal Resistance Wärmewiderstand Operating Temperatur Betriebstemperatur Storage Temperature Lagertemperatur Symbol tp≤100µs, τ=1:10 Min Max Unit If, max 20 mA If, pulse 50 mA UR 5 V Rth 450 K/W Top -40 +85 °C TSt -40 +85 °C Outline Drawing Zeichnung Recommended Soldering Pad Empfohlenes Lötpad Marking at anode Markierung an der Anode Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com preliminary edition 3/13 Page/Seite 2/7 1206 Standard OLS-150 MUR • Performace Diagram Kennlinien 100,0 3,0 rel Intensity [a.u.] Forward Current [mA] 2,5 10,0 2,0 1,5 1,0 0,5 0,0 1,0 1,00 1,20 1,40 1,60 1,80 2,00 2,20 Forward Voltage [V] 2,40 2,60 2,80 0 3,00 Forward Current vs. Forward Voltage Flussstrom über Flussspannung 10 20 30 Forward Current [mA] 40 50 40 50 Intensity vs. Forward Current Strahlstärke über Flussstrom 661,0 20 Peak Wavelength [nm] 660,5 IF [mA] 15 10 5 0 -40 -20 0 20 Top[°C] 40 60 660,0 659,5 659,0 80 0 Maximum Forward Current vs. Ambient Temprature Max. Flussstom über Umgebungstemperatur 10 20 30 Forward Current [mA] Forward Current vs. Shift Dominant Wavelength Flussstrom gegen Verschiebung der Wellenlänge 1,0 90 rel. Intensity [a.u.] 0,8 120 1,0 60 0,6 150 0,5 0,4 30 0,2 0,0 0,0 550 570 590 610 630 650 670 Wavelength [nm] 690 710 730 180 0 750 Spectrum @ 20mA Spektrum @ 20mA Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved View Angle Abstahlung www.osa-opto.com preliminary edition 3/13 Page/Seite 3/7 1206 Standard OLS-150 MUR • Soldering Conditions Lötprofile 300 10...20s Temperature [°C] 250 230°C IR reflow soldering profilefor lead containig solder 200 170°C 150 120°C 40s max. 100 IR reflow Lötprozess für bleihatiges Lot 3K/s max. 50 4K/s max 0 50 100 150 Time [s] 200 250 300 300 Temperature [°C] 250°C 245°C 250 217°C 3K/s max 200 180°C IR reflow soldering profile for lead free soldering 10...20s 60s max 150 IR Reflow Lötprozess für bleifreies Lot 120s max 100 4K/s max 50 3K/s max 0 Manual Soldering: Manuelles Löten: 50 100 150 Time [s] 200 250 300 max power of iron 25W / 300°C for 3s Max. Leistung des Lötkolben 25W / 300°C für 3s Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com preliminary edition 3/13 Page/Seite 4/7 1206 Standard OLS-150 MUR • Ordering Code For Parts Kodierung der Bestellnummer Series Serie Color Farbe OLS-150 - Encapsulation Verguss ??????? - ? C CD X XD Type definition, e.g. Typenbezeichnung z.B. • - Packaging Verpackung ? T TD – taped up − taped down – colored clear – colored diffused – uncolored clear – uncolored diffused OLS-150 MUR –X-T Tape And Reel Packing Gurt und Spule D 7’’ Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved Parts/reel 3000 www.osa-opto.com preliminary edition 3/13 Page/Seite 5/7 1206 Standard OLS-150 MUR Packing Verpackung The reel is sealed in special plastic bag with integrate ESD protection ( MIL - STD 81705 ) including a silica dry-pack. MSL level acc. to IPC/JEDEC J-STD 020D: Level 2 for Europe Level 2a for all other countries Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem HighshieldAntistatic-Beutel verschweißt. Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D: Schwellwert 2 für Europa Schwellwert 2a für alle anderen Länder Label Etikett Order No. Bestellnr. XXXXXXXXXX Type Typ ???-??? ???-?-? Intensity group Intensitätskgruppe ZZ Charge No. Chargennr. 1122-AAAAAA Quantity Anzahl 9999 Customer order No. Kundenspezifische Nr. Color Class: CC Color Class optional Farbklasse optional • LED Radiant Intensity Groups And Subgroups [mW/sr] Strahlstärkeklassen und Unterklassen (general information – not this device specific; Allgemeine informationen – nicht bauteilspezifisch) F: G: H: 1.12 1.80 2.80 - 1.80 2.80 4.50 F1: 1.12 - 1.40 F2: 1.40 - 1.80 G1: 1.80 - 2.24 G2: 2.24 - 2.80 H1: 2.80 - 3.55 H2: 3.55 - 4.50 Measured according to CIE 127. All SMD-LEDs are 100% measured and selected on full automated equipment with an accuracy of ± 11 %. Special service: Brightness selection in sub selections possible. Color selection in 3 sub selections possible (each subgroup per reel). Gemessen nach CIE127. Alle SMD-LEDs sind 100% gemessen und auf automatischen Anlagen mit einer Toleranz von ±11% selektiert. Spezieller Service: Selektion der Helligkeit in Unterklassen auf Anfrage möglich. Farbselektion in drei Unterklassen möglich (je eine Unterklasse pro Spule) Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com preliminary edition 3/13 Page/Seite 6/7 1206 Standard OLS-150 MUR Attention please The information describes the type of component and shall not considered as assured characteristics. Terms of delivery and rights to change reserved. The data sheet may changed without prior information; the valid issue will be on our webpage in internet. Due to technical requirements components may contain dangerous substances. Parameters can vary in different applications. All operating parameters must be validated for each customer application by the customer. OSA opto light GmbH does not have the responsibility for the reliability and the degradation behaviour of products made with OSA opto light GmbH diodes because they depend not only on the diode but also on the conditions of manufacture or design of the final products. The customer is responsible to approve the long term stability of the product according to customer’s requirements. Components used in toys, life support devices or systems or safety devices or systems must be expressly authorized by OSA opto light GmbH for such purpose! Packaging: OSA opto light GmbH uses recyclable packages, please use the recycling operators known to you. Zur Beachtung Dieses Datenblatt beschreibt typische, nicht uneingeschränkt garantierte Bauelementeigenschaften. Es gelten die AGB der OSA opto light GmbH, das Recht zur Änderung dieser ist vorbehalten. Änderungen im Sinne des technische Fortschritts vorbehalten, eine automatische Information erfolgt nicht. Die jeweils gültige Version ist auf unserer Internet- Seite vorhanden. Auf Grund technischer Erfordernisse können die Bauelemente gefährliche Substanzen enthalten. Produkteigenschaften können je nach Anwendung variieren. Die Produkteigenschaften müssen in der Anwendung durch den Kunden geprüft werden. Die OSA opto light GmbH ist nicht für die Zuverlässigkeit und das Alterungsverhalten von Produkten, die unter Verwendung von von der OSA opto light GmbH hergestellten Dioden gefertigt wurden, verantwortlich, da Beides nicht nur von den Dioden selbst, sondern auch von Konstruktion und Fertigung des Endproduktes abhängt. Der Kunde ist verpflichtet, das Langzeitverhalten des Produktes gemäß seiner Anforderungen zu prüfen und freizugeben. Werden die Dioden in Spielzeug, lebenserhaltenden oder sicherheitsrelevanten Systemen und Geräten eingesetzt, muss dies durch die OSA opto light GmbH ausdrücklich gestattest werden. Rückgabe von Verpackungsmaterial: Die OSA opto light GmbH verwendet wiederverwertbare Verpackung, bitte wenden Sie sich an einen örtlichen Verwerter. OSA Opto Light GmbH www.osa-opto.com Köpenicker Str.325 / Haus 201 12555 Berlin Germany Tel. +49 (0)30 65762683 contact@osa-opto.com Copyright © 2013 OSA Opto Light GmbH. All Rights Reserved www.osa-opto.com preliminary edition 3/13 Page/Seite 7/7