Absolute Maximum Ratings Electro-Optical

side view, cool white
OLS-210 MW
Features:
 for application mounting in side view
 size: 3,0(L) x 1,8(W) x 1,0(H) mm
 circuit substrate: glass laminated epoxy
 devices are ROHS and REACH conform
 lead free solderable, soldering pads: gold
plated
 taped in 8 mm blister tape, cathode to
transporting perforation
 all devices sorted into luminous intensity
classes
 sorted in color-temperatur (CCT) classes
 high luminous intensity types
Merkmale:
 Für seitliche Montage geeignet
 Größe: 3,0 x 1,8 x 1,0 mm
 Trägerstreifen: Glasfaserlaminat
 Bauteile sind ROHS und REACH konform
 Bleifrei lötbar, Lötpads: vergoldet
 Gegurtet in 8mm Blistergurt, Kathode zur
Transportperforation
 Alle Bauteile in Intensitätsklassen sortiert
 Sortiert in Farbtemperaturklassen
 Hohe Lichtstärke
 Electro-Optical Characteristics (T=25°C)
Elektrooptische Eigenschaften
Parameter
Emitting Color
Farbe
Forward Voltage
Flussspannung
Color Rendering Index
Farbwiedergabeindex
Color Temperatur
Farbtemperatur
Luminous Intensity
Lichtstärke
Reverse Current
Sperrstrom
Symbol
Condition
Uf
If = 15 mA
3.10
CRI
If = 15 mA
80%
Tc
If = 15 mA
6100
K
Iv
If = 15 mA
250
mcd
IR
UR = 5V
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
Min
180
Typ
cool white
kaltweiß
Max
3.70
100
Unit
V
μA
www.osa-opto.com
edition 8/15
Page/Seite 1/7
side view, cool white
OLS-210 MW
 Maximum Ratings
Grenzwerte
Parameter
Forward Current
Flussstrom
Forward Current, pulsed
Flussstrom, gepulst
Reverse Voltage
Sperrspannung
Thermal Resistance
Wärmewiderstand
Operating Temperatur
Betriebstemperatur
Storage Temperature
Lagertemperatur
Symbol
tp≤100μs, =1:10
Min
Max
Unit
If, max
15
mA
If, pulse
30
mA
UR
5
V
Rth
500
K/W
Top
-40
+65
°C
TSt
-40
+85
°C
Electrostatic discharge classification (MIL-STD-883)
Elektrostatische Empfindlichkeit
Outline Drawing
Zeichnung
class 2
Recommended Soldering Pad
Empfohlenes Lötpad
Marking at cathode
Markierung an der Kathode
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
www.osa-opto.com
edition 8/15
Page/Seite 2/7
side view, cool white
OLS-210 MW
 Performace Diagram
Kennlinien
10
1,5
rel. Intensity [a.u.]
2,0
Forward Current [mA]
100
1
1,0
0,5
0,1
0,0
0,01
2,00
2,20
2,40
2,60
2,80
3,00
Forward Voltage [V]
3,20
3,40
0
3,60
Forward Current vs. Forward Voltage
Flussstrom über Flussspannung
5
10
15
20
Forward Current [mA]
25
30
35
Intensity vs. Forward Current
Strahlstärke über Flussstrom
0,42
15
0,38
Class 3
0,34
Cy
IF [mA]
10
Class 2
0,30
5
Class 1
0,26
0
-40
-20
0
20
Top[°C]
40
0,22
60
0,26
0,28
0,30
0,32
0,34
0,36
Cx
Maximum Forward Current vs. Ambient Temprature
Max. Flussstom über Umgebungstemperatur
Color coordinates and classes
Farbkoordinaten und -klassen
1,0
90
rel. Intensity [a.u.]
0,8
120
1,0
60
0,6
150
30
0,5
0,4
0,2
0,0
0,0
350
400
450
500
550
600
650
Wavelength [nm]
700
750
800
180
0
850
Spectrum @ 15mA
Spektrum
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
View Angle
Abstahlung
www.osa-opto.com
edition 8/15
Page/Seite 3/7
side view, cool white
OLS-210 MW
 Soldering Conditions
Lötprofile
300
10...20s
Temperature [°C]
250
230°C
IR reflow soldering
profilefor lead
containig solder
200
170°C
150
120°C
40s max.
IR reflow
Lötprozess für
bleihatiges Lot
100
3K/s max.
50
4K/s max
0
50
100
150
Time [s]
200
250
300
300
217°C
3K/s max
Temperature [°C]
250°C
245°C
250
200
180°C
IR reflow soldering
profile for lead free
soldering
10...20s
60s max
150
IR Reflow
Lötprozess für
bleifreies Lot
120s max
100
4K/s max
50
3K/s max
0
Manual Soldering:
Manuelles Löten:
50
100
150
Time [s]
200
250
300
max power of iron 25W / 300°C for 3s
Max. Leistung des Lötkolben 25W / 300°C für 3s
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
www.osa-opto.com
edition 8/15
Page/Seite 4/7
side view, cool white
OLS-210 MW
 Ordering Code For Parts
Kodierung der Bestellnummer
Series
Serie
Color
Farbe
OLS-210
-
Encapsulation
Verguss
???????
-
?
-
Packaging
Verpackung
?
T
X
XD
Type definition, e.g.
Typenbezeichnung z.B.

– taped
– uncolored clear
– uncolored diffused
OLS-210 MW –X-T
Tape And Reel Packing
Gurt und Spule
D
7’’
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
Parts/reel
3000
www.osa-opto.com
edition 8/15
Page/Seite 5/7
side view, cool white
OLS-210 MW
Packing
Verpackung
The reel is sealed in special plastic bag with integrate ESD protection
( MIL - STD 81705 ) including a silica dry-pack.
MSL level acc. to IPC/JEDEC J-STD 020D:
Level 2 for Europe
Level 2a for all other countries
Die Rolle wird zusammen mit einem Trockenmittelbeutel in einem HighshieldAntistatic-Beutel verschweißt.
Feuchtigkeitsempfindlichkeitsschwellwert (MSL) gemäß J-STD 020D:
Schwellwert 2 für Europa
Schwellwert 2a für alle anderen Länder
Label
Etikett
Order No.
Bestellnr.
XXXXXXXXXX
Type
Typ
???-??? ???-?-?
Intensity group
Intensitätskgruppe
ZZ
Charge No.
Chargennr.
1122-AAAAAA
Quantity
Anzahl
9999
Customer order No.
Kundenspezifische Nr.
Color Class: CC
Color Class optional
Farbklasse optional
 LED Radiant Intensity Groups And Subgroups [mcd]
Strahlstärkeklassen und Unterklassen
(general information – not this device specific; Allgemeine informationen – nicht bauteilspezifisch)
R:
S:
T:
112
180
280
-
180
280
450
R1 :
112
-
140
R2 :
140
-
180
S1 :
180
-
224
S2 :
224
-
280
T1 :
280
-
355
T2 :
355
-
450
Measured according to CIE 127. All SMD-LEDs are 100% measured and selected on full automated
equipment with an accuracy of ± 11 %.
Special service: Brightness selection in sub selections possible.
Color selection in 3 sub selections possible (each subgroup per reel).
Gemessen nach CIE127. Alle SMD-LEDs sind 100% gemessen und auf automatischen Anlagen mit einer
Toleranz von ±11% selektiert.
Spezieller Service: Selektion der Helligkeit in Unterklassen auf Anfrage möglich.
Farbselektion in drei Unterklassen möglich (je eine Unterklasse pro Spule)
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
www.osa-opto.com
edition 8/15
Page/Seite 6/7
side view, cool white
OLS-210 MW
Attention please
The information describes the type of component and shall not considered as assured characteristics. Terms
of delivery and rights to change reserved. The data sheet may changed without prior information; the valid
issue will be on our webpage in internet. Due to technical requirements components may contain dangerous
substances.
Parameters can vary in different applications. All operating parameters must be validated for each customer
application by the customer. OSA opto light GmbH does not have the responsibility for the reliability and the
degradation behaviour of products made with OSA opto light GmbH diodes because they depend not only
on the diode but also on the conditions of manufacture or design of the final products. The customer is
responsible to approve the long term stability of the product according to customer’s requirements.
Components used in toys, life support devices or systems or safety devices or systems must be expressly
authorized by OSA opto light GmbH for such purpose!
Packaging: OSA opto light GmbH uses recyclable packages, please use the recycling operators known to you.
Zur Beachtung
Dieses Datenblatt beschreibt typische, nicht uneingeschränkt garantierte Bauelementeigenschaften. Es gelten
die AGB der OSA opto light GmbH, das Recht zur Änderung dieser ist vorbehalten. Änderungen im Sinne des
technische Fortschritts vorbehalten, eine automatische Information erfolgt nicht. Die jeweils gültige Version
ist auf unserer Internet- Seite vorhanden. Auf Grund technischer Erfordernisse können die Bauelemente
gefährliche Substanzen enthalten.
Produkteigenschaften können je nach Anwendung variieren. Die Produkteigenschaften müssen in der
Anwendung durch den Kunden geprüft werden. Die OSA opto light GmbH ist nicht für die Zuverlässigkeit
und das Alterungsverhalten von Produkten, die unter Verwendung von von der OSA opto light GmbH
hergestellten Dioden gefertigt wurden, verantwortlich, da Beides nicht nur von den Dioden selbst, sondern
auch von Konstruktion und Fertigung des Endproduktes abhängt. Der Kunde ist verpflichtet, das
Langzeitverhalten des Produktes gemäß seiner Anforderungen zu prüfen und freizugeben. Werden die
Dioden in Spielzeug, lebenserhaltenden oder sicherheitsrelevanten Systemen und Geräten eingesetzt, muss
dies durch die OSA opto light GmbH ausdrücklich gestattest werden.
Rückgabe von Verpackungsmaterial: Die OSA opto light GmbH verwendet wiederverwertbare Verpackung,
bitte wenden Sie sich an einen örtlichen Verwerter.
OSA Opto Light GmbH
www.osa-opto.com
Köpenicker Str.325 / Haus 201
12555 Berlin Germany
Tel. +49 (0)30 65762683
contact@osa-opto.com
Copyright © 2015 OSA Opto Light GmbH. All Rights Reserved
www.osa-opto.com
edition 8/15
Page/Seite 7/7