LOGIC L9D3512M32DBG2

PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Benefits
FEATURES
DDR3 Integrated Module [iMOD]:
x9DD 9DD4 999
x9FHQWHUWHUPLQDWHGSXVKSXOO
,2
x3DFNDJHPP[PP[PP
[PDWUL[ZEDOOV
x0DWUL[EDOOSLWFKPP
6SDFHVDYLQJIRRWSULQW
7KHUPDOO\HQKDQFHG,PSHGDQFH
PDWFKHGLQWHJUDWHGSDFNDJLQJ
'LIIHUHQWLDOELGLUHFWLRQDOGDWDVWUREH
QELWSUHIHWFKDUFKLWHFWXUH
LQWHUQDOEDQNVSHUZRUGZRUGV
LQWHJUDWHGLQSDFNDJH
1RPLQDODQGG\QDPLFRQGLHWHUPLQDWLRQ2'7IRUGDWDVWUREHDQGPDVN
VLJQDOV
3URJUDPPDEOH&$65($'ODWHQF\
&/DQG
&$6:5,7(ODWHQF\&:/
and 13
)L[HGEXUVWOHQJWK%/RIDQGEXUVW
FKRS%&RI
6HOHFWDEOH%&RU%/RQWKHIO\
27)
6HOI$XWR5HIUHVKPRGHV
2SHUDWLQJ7HPSHUDWXUH5DQJH
DPELHQWWHPS 7$
x,QGXVWULDO“&WR“&VXSSRUWLQJ
6(/)$8725()5(6+
x([WHQGHG“&WR“&PDQXDO
5()5(6+RQO\
x0LO7HPS“&WR“&PDQXDO
5()5(6+RQO\
&25(FORFNLQJIUHTXHQFLHV
0+]
'DWD7UDQVIHU5DWHV
0ESV
:ULWHOHYHOLQJ
0XOWLSXUSRVHUHJLVWHU
2XWSXW'ULYHU&DOLEUDWLRQ
%RDUGDUHDVDYLQJVZLWKVXUIDFH
PRXQWIULHQGO\SLWFKPP
Reduced interconnect routing
5HGXFHGWUDFHOHQJWKVGXHWR
WKHKLJKO\LQWHJUDWHGLPSHGDQFH
PDWFKHGSDFNDJLQJ
7KHUPDOO\HQKDQFHGSDFNDJLQJ
WHFKQRORJ\DOORZVLOLFRQLQWHJUDWLRQ
ZLWKRXWSHUIRUPDQFHGHJUDGDWLRQGXH
WRSRZHUGLVVLSDWLRQKHDW
+LJK7&(RUJDQLFODPLQDWHLQWHUSRVHUIRULPSURYHGJODVVVWDELOLW\
RYHUDZLGHRSHUDWLQJWHPSHUDWXUH
6XLWDELOLW\RIXVHLQ+LJK5HOLDELOLW\
DSSOLFDWLRQVUHTXLULQJ0LOWHPSQRQ
KHUPHWLFGHYLFHRSHUDWLRQ
1RWH7KLVLQWHJUDWHGSURGXFWDQGRULWVVSHFLILFDWLRQV
DUHVXEMHFWWRFKDQJHZLWKRXWQRWLFH/DWHVWGRFXPHQW
VKRXOGEHUHWULHYHGIURP/',SULRUWR\RXUGHVLJQ
FRQVLGHUDWLRQ
iMOD Part Information
ORDER NUMBER
SPEED GRADE
/'0'%*[
DDR3-1866
L9D3256M32DBG2x125
DDR3-1600
L9D3256M32DBG2x15
DDR3-1333
/'0'%*[
DDR3-1866
L9D3512M32DBG2x125
DDR3-1600
L9D3512M32DBG2x15
DDR3-1333
PKG FOOTPRINT
I/O
PITCH
PP[PP
PP
PKG NO.
BG2
integrated module products
LOGIC Devices Incorporated
www.logicdevices.com
1
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FEATURES
FIGURE 1 - 1Gb DDR3 PART NUMBERS
Sample Part Number:
L9D3
256M
32D
L9D3256G32DBG2I107
BG2
107
I
DDR3 iMOD
Word = 256 MB
Code
Speed Grade
15
1.5ns / 667MHz
125
1.25ns / 800MHz
107
1.07ns / 933MHz
Wordwidth
x32
D = Dual Channel
16 x 22mm
PBGA
Temperature
Code
Commercial (0oC to 70oC)
C
Industrial (-40oC to 85oC)
I
o
o
Extended (-40 C to 105 C)
E
Military (-55oC to 125oC)
M
Note: Not all options can be combined. Please see our Part Catalog for available offerings.
TABLE 1: ADDRESSING
Parameter
2 x 256-512 Meg x 32
&RQILJXUDWLRQ
[0HJ[EDQNV[ELWV
5HIUHVK&RXQW
8K
52:$GGUHVVLQJ
.$>@
%DQN$GGUHVVLQJ
%$>@
&ROXPQ$GGUHVVLQJ
.$>@.$>@
256 M
LOGIC Devices Incorporated
www.logicdevices.com
2
512M
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
STATE DIAGRAM
FIGURE 2 - SIMPLIFIED STATE DIAGRAM
CKE L
Power
applied
Power
on
Reset
Procedure
MRS, MPR,
write
leveling
Initialization
Self
refresh
SRE
ZQCL
MRS
SRX
From any
state
RESET
ZQ
Calibration
REF
ZQCL/ZQCS
Idle
Refreshing
PDE
ACT
PDX
Active
PowerDown
Preharge
PowerDown
Activating
PDX
CKE L
CKE L
PDE
Bank
Active
WRITE
WRITE
READ
WRITE AP
READ AP
READ
Writing
READ
Reading
WRITE
READ AP
WRITE AP
WRITE AP
READ AP
PRE, PREA
Writing
PRE, PREA
Preharging
PRE, PREA
Reading
Automatic
Sequence
Command
Sequence
ACT = ACTIVATE
MPR = Multipurpose register
MRS = Mode register set
PDE = Power-down entry
PDX = Power-down exit
PRE = PRECHARGE
LOGIC Devices Incorporated
www.logicdevices.com
PREA=PRECHARGE ALL
READ = RD, RDS4, RDS8
READ AP = RDAP, RDAPS4, RDAPS8
REF = REFRESH
RESET = START RESET PROCEDURE
SRE = Self refresh entry
3
SRX = Self refresh exit
WRITE = WR, WRS4, WRS8
WRITE AP = WRAP, WRAPS4, WRAPS8
ZQCL = ZQ LONG CALIBRATION
ZQCS = ZQ SHORT CALIBRATION
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
INDUSTRIAL TEMPERATURE
FUNCTIONAL DESCRIPTION
7KH ''5 6'5$0 XVHV GRXEOH GDWD UDWH DUFKLWHFWXUH WR DFKLHYH KLJK
VSHHGRSHUDWLRQ7KHGRXEOHGDWDUDWH''5DUFKLWHFWXUHLVDQQSUHIHWFK
ZLWKDQLQWHUIDFHGHVLJQHGWRWUDQVIHUWZRGDWDZRUGVSHUFORFNF\FOHDWWKH
,2SLQV$VLQJOH5($'RU:5,7(DFFHVVIRUWKH''56'5$0FRQVLVWV
RIDVLQJOHQELWZLGHRQHFORFNF\FOHGDWDWUDQVIHUDWWKHLQWHUQDOPHPRU\
FRUHDQGHLJKWFRUUHVSRQGLQJQELWZLGHRQHKDOIFORFNF\FOHGDWDWUDQVIHU
DWWKH,2SLQ
7KH LQGXVWULDO WHPSHUDWXUH , GHYLFH UHTXLUHV WKH DPELHQW WHPSHUDWXUH
QRWH[FHHG“&RU“&-('(&VSHFLILFDWLRQVUHTXLUHWKH5()5(6+
UDWHWRGRXEOHZKHQ7$H[FHHGV“&WKLVDOVRUHTXLUHVXVHRIWKHKLJK
WHPSHUDWXUH6(/)5()5(6+RSWLRQ$GGLWLRQDOO\2'7UHVLVWDQFHDQG
WKH ,1387287387 LPSHGDQFH PXVW EH GHUDWHG ZKHQ WKH 7$ LV “&
RU!“&
7KHGLIIHUHQWLDOVWUREHV/'46[/'46[?8'46[8'46[?DUHWUDQVPLWWHGH[WHUQDOO\DORQJZLWKGDWDIRUXVHLQGDWDFDSWXUHDWWKH''56'5$0
LQSXW UHFHLYHU '46 LV FHQWHUDOLJQHG ZLWK GDWD IRU :5,7(V 7KH 5($'
GDWD LV WUDQVPLWWHG E\ WKH ''5 6'5$0 DQG HGJHDOLJQHG WR WKH GDWD
VWUREHV
EXTENDED TEMPERATURE
7KH([WHQGHGWHPSHUDWXUH(GHYLFHUHTXLUHVWKHDPELHQWWHPSHUDWXUH
QRWH[FHHG“&RU“&-('(&VSHFLILFDWLRQVUHTXLUHWKHUHIUHVK
UDWHWRGRXEOHZKHQ7$H[FHHGV“&WKLVDOVRUHTXLUHVXVHRIWKHKLJK
WHPSHUDWXUH6(/)5()5(6+RSWLRQ$GGLWLRQDOO\2'7UHVLVWDQFHDQG
WKH ,1387287387 LPSHGDQFH PXVW EH GHUDWHG ZKHQ WKH 7$ LV “&
or >85“&
7KH ''5 6'5$0 RSHUDWHV IURP D GLIIHUHQWLDO FORFN &.[ &.[? 7KH
FURVVLQJRI&.JRLQJ+,*+DQG&.?JRLQJ/2:LVUHIHUUHGWRDVWKHSRVLWLYHHGJHRI&ORFN&.&RQWURO&RPPDQGDQG$GGUHVVVLJQDOVDUHUHJLVWHUHGDWHYHU\SRVLWLYHHGJHRI&.,QSXWGDWDLVUHJLVWHUHGRQWKHILUVW
ULVLQJ HGJH RI '46 DIWHU WKH :5,7( SUHDPEOH DQG RXWSXW GDWD LV UHIHUHQFHGRQWKHILUVWULVLQJHGJHRI'46DIWHUWKH5($'SUHDPEOH
MILITARY, EXTREME OPERATING TEMPERATURE
5($' DQG :5,7( DFFHVVHV WR WKH ''5 6'5$0 DUH EXUVWRULHQWHG
$FFHVVHV VWDUW DW D VHOHFWHG ORFDWLRQ DQG FRQWLQXH IRU D SURJUDPPHG
QXPEHURIORFDWLRQVLQDSURJUDPPHGVHTXHQFH$FFHVVHVEHJLQZLWKWKH
UHJLVWUDWLRQRIDQ$&7,9$7(FRPPDQGZKLFKLVWKHQIROORZHGE\D5($'
RU:5,7(FRPPDQG7KHDGGUHVVELWVUHJLVWHUHGFRLQFLGHQWZLWKWKH$&7,9$7(FRPPDQGDUHXVHGWRVHOHFWWKHEDQNDQGWKHVWDUWLQJFROXPQORFDWLRQIRUWKHEXUVWDFFHVV
7KH0LO7HPS0GHYLFHUHTXLUHVWKHDPELHQWWHPSHUDWXUHQRWH[FHHG
-55“&RU“&-('(&UHTXLUHVWKH5()5(6+UDWHGRXEOHZKHQ7$
H[FHHGV“&DQG/',UHFRPPHQGVDQDGGLWLRQDOGHUDWLQJDVVSHFLILHG
LQ WKLV GRFXPHQW DV WR SURSHUO\ PDLQWDLQ WKH '5$0 FRUH FHOO FKDUJH DW
WHPSHUDWXUHVDERYH7$>105“&
''56'5$0GHYLFHVXVH5($'DQG:5,7(%/DQG%&$Q$872
35(&+$5*(IXQFWLRQPD\EHHQDEOHGWRSURYLGHDVHOIWLPHG52:35(&+$5*(WKDWLVLQLWLDWHGDWWKHHQGRIWKHEXUVWDFFHVV
$VZLWKVWDQGDUG''56'5$0GHYLFHVWKHSLSHOLQHGPXOWLEDQNDUFKLWHFWXUHRIWKH''56'5$0DOORZVIRUFRQFXUUHQWRSHUDWLRQWKHUHE\SURYLGLQJKLJKEDQGZLGWKE\KLGLQJ52:35(&+$5*(DQG$&7,9$7,21WLPH
$ 6(/) 5()5(6+ PRGH LV SURYLGHG IRU DOO WHPSHUDWXUH JUDGH RIIHULQJV
DORQJZLWK$8726(/)5()5(6+IRU,QGXVWULDOSURGXFWDVZHOODVSRZHU
VDYLQJ32:(5'2:1PRGH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 3A - L9D3256M32DBG2 FUNCTIONAL BLOCK DIAGRAM
CSA
RESETA
ODTA
WEA
RASA, CASA
CKEA
CKA, CKA#
BA0-2A
ADDR0-15A
ADDR
BA
DM3A
CK, CKE RAS, WE
CK#
CAS
ODT RESET CSA
DIE 1A
DM2A
DQ 15
DQ 8
DQ 7
DQ 0
ZQ
VSSQ
ADDR
BA
CK, CKE RAS, WE
CK#
CAS
ODT RESET CSA
DIE 0A
DM1A
DQ 15
DQ 8
DQ 7
DQ 0
DM0A
ZQ
DQS3A, DQS3A#
DQ 31A
DQ 24A
DQS2A, DQS2A#
DQ 23A
DQ 16A
DQS1A, DQS1A#
DQ 15A
DQ 8A
DQS0A, DQS0A#
DQ 7A
DQ 0A
VSSQ
DIE 1B
DM3B
DM2B
ZQ
ADDR
BA
VSSQ
CK, CKE RAS, WE
CK#
CAS
ODT RESET CSB
DIE 0B
DM1B
DM0B
ZQ
ADDR
VSSQ
BA
CK, CKE RAS, WE
CK#
CAS
ODT RESET CSB
DQ 15
DQ 8
DQ 7
DQ 0
DQ 15
DQ 8
DQ 7
DQ 0
DQS3B, DQS3B#
DQ 31B
DQ 24B
DQS2B, DQS2B#
DQ 23B
DQ 16B
DQS1B, DQS1B#
DQ 15B
DQ 8B
DQS0B, DQS0B#
DQ 7B
DQ 0B
ADDR0-15B
BA0-2B
CKB, CKB#
CKEB
RASB, CASB
WEB
ODTB
RESETB
CSB
LOGIC Devices Incorporated
www.logicdevices.com
5
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 3B - L9D3512M32DBG2 FUNCTIONAL BLOCK DIAGRAM
CS1A
CS0A
RESETA#
ODTA
WEAb
RASA#, CASA#
CKEA
CKA, CKA#
BA0-2A
ADDR0-15A
ADDR
BA
ZQ
CK, CKE RAS, WE
CK#
CAS
ODT RESET CS0 CS1
DQ 7
DQ 0
VSSQ
DM0A
DIE 0A
DM1A
DIE 1A
DQ 7
DQ 0
ZQ
VSSQ
ADDR
BA
ZQ
VSSQ
CK, CKE RAS, WE
CK#
CAS
ODT RESET CS0 CS1
DQ 7
DQ 0
DIE 2A
DIE 3A
DM2A
DM3A
DQ 7
DQ 0
ZQ
DQS0A, DQS0A#
DQ 31A
DQ 24A
DQS1A, DQS1A#
DQ 23A
DQ 16A
DQS2A, DQS2A#
DQ 15A
DQ 8A
DQS3A, DQS3A#
DQ 7A
DQ 0A
VSSQ
ZQ
DQ 7
DQ 0
DIE 3B
DIE 2B
VSSQ
DM3B
DM2B
ZQ
ADDR
BA
CK, CKE RAS, WE
CK#
CAS
ODT RESET CS0 CS1
DQ 7
DQ 0
DQS3B, DQS3B#
DQ 31B
DQ 24B
DQS2B, DQS2B#
DQ 23B
DQ 16B
VSSQ
DQ 7
DQ 0
ZQ
DIE 1B
DIE 0B
VSSQ
DM1B
DM0B
ZQ
ADDR
VSSQ
BA
CK, CKE RAS, WE
CK#
CAS
ODT RESET CS0 CS1
DQ 7
DQ 0
DQS1B, DQS1B#
DQ 15B
DQ 8B
DQS0B, DQS0B#
DQ 7B
DQ 0B
ADDR0-15B
BA0-2B
CKB, CKB#
CKEB
RASB#, CASB#
WEB#
ODTB
RESETB#
CS0B
CS1B
LOGIC Devices Incorporated
www.logicdevices.com
6
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
BALL /SIGNAL LOCATION (PBGA)
FIGURE 4 - PINOUT TOP VIEW
1
2
3
4
5
6
7
8
9
10
11
12
13
A
VssQ
VDDQ
VssQ
VDDQ
VssQ
VDDQ
VssQ
Vss
A14A
A13A
A8A
VDD
VSS
A
B
DQ9A
DQS1A
A6A
A2A
B
C
DQS1A# DQ13A DQ15A DQ14A DQ12A
VDD
DQ11A DQ10A
DQ8A
DQ0A
DQ2A
DQ3A
DQ1A
VSS
RFU
A4A
A5A
A1A
A3A
C
D
VDDQ
VSSQ
VDDQ
VSSQ
VDDQ
VSSQ
VDDQ
VDD
A12A
DM1A
A0A
BA1A
DM0A
D
E
DQ4A
DQ6A
DQ7A
DQ5A
DQS0A#
DQS0A
VssQ
VDD
RESETA#
BA0A
BA2A
Vss
VDD
E
DQ20A DQ22A DQ23A DQ21A DQS2A#
DQS2A
VDDQ
VSS
CSA1# VREFCAA CSA0#
VDD
VSS
F
VDDQ
VssQ
VDD
RFU
A10A
WEA#
ODTA
CKEA
G
F
G
VssQ
VDDQ
VssQ
VDDQ
VssQ
A9A
A11A
A7A
H
DQ26A DQ24A DQ16A DQ18A DQ19A DQ17A
VDD
VSS
VREFDQA
VSS
CASA#
CLKA
VDD
H
J
DQ27A DQ25A
DQS3A# DQ29A DQ31A
Vss
VDD
VDDDLLA
VDD
RASA# CLKA#
VSS
J
K
L
M
VDDQ
VSSQ
DQS3A
VDDQ
VSSQ
DQ28A DQ30A DQ28B DQ30B
VSSQ
VDDQ
VDDQ
VSSQ
VDDQ
VSS
VSSDLLA
VSS
VDD
DM2A
DM3A
K
Vss
VDD
Vss
VDD
Vss
VDD
Vss
VDD
VSS
L
VSSQ
VDDQ
VSSQ
VSS
VSSDLLB
VSS
VDD
DM2B
DM3B
M
VSSQ
VDDQ
DQS3B
DQS3B# DQ29B
N
DQ27B DQ25B
DQ31B
Vss
VDD
VDDDLLB
VDD
RASB# CLKB#
VSS
N
P
DQ26B DQ24B DQ16B DQ18B DQ19B DQ17B
VDD
VSS
VREFDQB
VSS
CASB#
CLKB
VDD
P
R
VDDQ
RFU
A10B
WEB#
ODTB
CKEB
R
T
VSSQ
VDDQ
VSSQ
VDDQ
VSSQ
VDDQ
VDD
DQ20B DQ22B DQ23B DQ21B DQS2B# DQS2B
VSSQ
VSS
CSB1# VREFCAB CSB0#
VDD
VSS
T
U
DQ4B
DQ6B
DQ7B
DQ5B
DQS0B#
DQS0B
VDDQ
VDD
RESETB#
BA0B
BA2B
Vss
VDD
U
V
VSSQ
VDDQ
VSSQ
VDDQ
VSSQ
VDDQ
VSSQ
VDD
A12B
DM1B
A0B
BA1B
DM0B
V
W
DQ11B DQ10B
DQ8B
DQ0B
DQ2B
DQ3B
DQ1B
VSS
RFU
A4B
A5B
A1B
A3B
W
Y
DQ9B
DQS1B
VDD
A9B
A11B
A7B
A6B
A2B
Y
AA
VDDQ
VSSQ
VDDQ
VSSQ
VDDQ
VSSQ
VDDQ
Vss
A14B
A13B
A8B
VDD
VSS
1
2
3
4
5
6
7
8
9
10
11
12
13
DQS1B# DQ13B DQ15B DQ14B DQ12B
GND (Core)
V + (Core Power)
Data IO
Address
GND (I/O)
V + (I/O Power)
Level REF
RFU
VSSDLL
VDDDLL
CNTRL
AA
271BGA-1.00MM PITCH - X64, SCB
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 2 - BALL/SIGNAL LOCATION AND DESCRIPTION
Ball Assignments
$$$%%
Symbol
Type
A0A, A1A,
Input Address Inputs: 3URYLGHWKH52:DGGUHVVIRU$&7,9$7(FRPPDQGVDQGWKHFROXPQDGGUHVV
Description
%%%&& A2A, A3A,
DQGDXWRSUHFKDUJHELW$10IRU5($'<:5,7(FRPPDQGVWRVHOHFWRQHORFDWLRQRXWRIWKH
&&&'' A4A, A5A,
PHPRU\DUUD\LQWKHUHVSHFWLYHEDQN$10VDPSOHGGXULQJD35(&+$5*(FRPPDQGGHWHUPLQHV
A6A, A7A,
ZKHWKHUWKH35(&+$5*(DSSOLHVWRRQHEDQN$10/2:EDQNVHOHFWHGE\%$>@RUDOOEDQNV
A8A, A9A,
$10+,*+7KHDGGUHVVLQSXWVDOVRSURYLGHWKHRSFRGHGXULQJD/2$'02'(FRPPDQG
A10A /AP,
$GGUHVVLQSXWVDUHUHIHUHQFHGWR9UHI&$$12%&ZKHQHQDEOHGLQWKHPRGHUHJLVWHU05$12
G10
A11A, A12A /
BC, A13A,
LVVDPSOHGGXULQJ5($'DQG:5,7(FRPPDQGVWRGHWHUPLQHZKHWKHUEXUVWFKRS/2: %&
EXUVWFKRS
A14A, A15A
'((
BA0A, BA1A, Input Bank Address Inputs: %$>@GHILQHWKHEDQNWRZKLFKDQ$&7,9$7(5($':5,7(RU
BA2A
35(&+$5*(FRPPDQGLVEHLQJDSSOLHG%$>@GHILQHZKLFKPRGHUHJLVWHU050, MR1, MR2, or
MR3LVORDGHGGXULQJWKH/2$'02'(FRPPDQG%$>@DUHUHIHUHQFHGWR9UHI&$
+-
CLKAX,
CLKAX#
Input Clock: &/.[DQG&/.[DUHGLIIHUHQWLDOFORFNLQSXWVRQHGLIIHUHQWLDOSDLUSHU:25'IRXU:25'V
FRQWDLQHGLQWKH/'[[*SURGXFW$OOFRQWURODQGDGGUHVVLQSXWVLJQDOVDUHVDPSOHGRQWKH
FURVVLQJRIWKHSRVLWLYHHGJHRI&/.[DQGWKHQHJDWLYHHGJHRI&/.[2XWSXWGDWDVWUREHV
'46['46[LVUHIHUHQFHGWRWKHFURVVLQJRI&/.[DQG&/.[
G13
CKEA
Input Clock Enable: &.(HQDEOHVDQGGLVDEOHVLQWHUQDOFLUFXLWU\DQGFORFNVRQWKH6'5$07KH
VSHFLILFFLUFXLWU\WKDWLVHQDEOHGGLVDEOHGLVGHSHQGHQWXSRQWKH''56'5$0FRQILJXUDWLRQDQG
RSHUDWLQJPRGH7DNLQJ&.(/2:SURYLGHV35(&+$5*(SRZHUGRZQDQG6(/)5()5(6+
RSHUDWLRQVDOOEDQNVLGOHRUDFWLYHSRZHUGRZQURZDFWLYHLQDQ\EDQN&.(LVV\QFKURQRXV
IRUSRZHUGRZQHQWU\DQGH[LWDQGIRUVHOIUHIUHVKHQWU\&.(LVDV\QFKURQRXVIRUVHOIUHIUHVK
H[LW,QSXWEXIIHUVH[FOXGLQJ&/.[&/.[&.(5(6(7DQG2'7DUHGLVDEOHGGXULQJ6(/)
5()5(6+&.(LVUHIHUHQFHGWR9UHI&$
F11
CSA#
Input Chip Select: &6HQDEOHVUHJLVWHUHG/2:DQGGLVDEOHVWKHFRPPDQGGHFRGHU$OOFRPPDQGV
DUHPDVNHGZKHQ&6LVUHJLVWHUHG+,*+&6SURYLGHVIRUH[WHUQDOUDQNVHOHFWLRQRQV\VWHPV
ZLWKPXOWLSOH UDQNV&6LVFRQVLGHUHGSDUWRIWKHFRPPDQGFRGH&6LVUHIHUHQFHGWR9UHI&$
D10, D13, K12, K13,
DMxA
Input Input Data Mask: '0[LVWKHE\WHZLGHGDWDPDVNIRUWKHUHVSHFWLYHELWGDWDILHOGV7KHGDWD
PDVNLQSXWPDVNV:5,7(GDWD%\WHGDWDLVPDVNHGZKHQ'0[LVVDPSOHG+,*+'0[SLQVDUH
VWUXFWXUHGDVLQSXWVRQO\WKHSLQVHOHFWULFDOORDGLQJLVGHVLJQHGWRPDWFKWKDWRIWKH'4'46[
'46[SLQV
-
RASA#
Input ROW Address Strobe/Select: 'HILQHVWKHFRPPDQGEHLQJHQWHUHGDORQJ&$6:(DQG&6
7KLVLQSXWSLQLVUHIHUHQFHGWR9UHI&$
+
CASA#
Input COLUMN Address Strobe/Select: 'HILQHVWKHFRPPDQGEHLQJHQWHUHGDORQJZLWK5$6:(
DQG&67KLVLQSXWSLQLVUHIHUHQFHGWR9UHI&$
G11
WEA#
Input WRITE Enable Input: 'HILQHVWKHFRPPDQGEHLQJHQWHUHGDORQJZLWK&$65$6DQG&6
7KLVLQSXWSLQLVUHIHUHQFHGWR9UHI&$
LOGIC Devices Incorporated
www.logicdevices.com
8
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 2 - BALL/SIGNAL LOCATION AND DESCRIPTION CONTINUED
Ball Assignments
Symbol
Type
G12
ODTA
Input
Description
On-Die Termination: 2'7HQDEOHVZKHQUHJLVWHUHG+,*+DQGGLVDEOHVWHUPLQDWLRQUHVLVWDQFHLQWHUQDOWRWKH''56'5$0:KHQHQDEOHGLQQRUPDORSHUDWLRQ2'7LVRQO\DSSOLHG
WRHDFKRIWKHIROORZLQJVLJQDOV'4>@'46[DQG'0[7KH2'7LQSXWLVLJQRUHGLI
GLVDEOHGYLDWKH/2$'02'(UHJLVWHUFRPPDQG2'7LVUHIHUHQFHGWR9UHI&$
(
RESETA#
Input
RESET: $QLQSXWFRQWUROSLQDFWLYH/2:UHIHUHQFHGWR9VV7KH5(6(7LQSXWUHFHLYHULV
D&026LQSXWGHILQHGDVDUDLOWRUDLOVLJQDOZLWK'&+,*+t[9DDDQG'&/2:d 0.2 x
9DD45(6(7DVVHUWLRQDQGGHDVVHUWLRQDUHDV\QFKURQRXV
(())
DQSxA,
%%--
DQSxA#
&&&&((
DQ0A, DQ1A,
((
DQ2A, DQ3A,
Input
Data Strobe Byte (per WORD): 2XWSXWHGJHDOLJQHGZLWK5($'GDWD,QSXWFHQWHUDOLJQHG
ZLWK:5,7(GDWD
I/O
Data Input/Output: /2:%\WH/2::25':25'3LQUHIHUHQFHGWR9UHI'4
I/O
Data Input/Output: +,*+%\WH/2::25':25'3LQUHIHUHQFHGWR9UHI'4
I/O
Data Input/Output: /2:%\WH:25'3LQUHIHUHQFHGWR9UHI'4
I/O
Data Input/Output: +,*+%\WH:25'3LQUHIHUHQFHGWR9UHI'4
DQ4A, DQ5A,
DQ6A, DQ7A
%%%%%&
DQ8A, DQ9A,
&&
DQ10A, DQ11A,
DQ12A, DQ13A,
DQ14A, DQ15A
))))++
DQ16A, DQ17A,
++
DQ18A, DQ19A,
DQ20A, DQ21A,
DQ22A, DQ23A
++----
DQ24A, DQ25A,
L1, L2
DQ26A, DQ27A,
DQ28A, DQ29A,
DQ30A, DQ31A
K9
VSSDLLA
*URXQGIRU'//
-
VDDDLLA
6XSSO\IRU'//
F10
VrefCAA
Supply 9ROWDJH5HIHUHQFH&25(9UHI&$PXVWEHPDLQWDLQHGDWDOOWLPHV
+
VrefDAA
Supply 9ROWDJH5HIHUHQFH,29UHI'4PXVWEHPDLQWDLQHGDWDOOWLPHV
LOGIC Devices Incorporated
www.logicdevices.com
9
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 2 - BALL/SIGNAL LOCATION AND DESCRIPTION CONTINUED
Ball Assignments
Symbol
599:: A0B, A1B,
Type
Description
L
Input Address Inputs: 3URYLGHWKH52:DGGUHVVIRU$&7,9$7(FRPPDQGVDQGWKHFROXPQDGGUHVV
:::<
A2B, A3B,
DQGDXWRSUHFKDUJHELW$10IRU5($'<:5,7(FRPPDQGVWRVHOHFWRQHORFDWLRQRXWRIWKH
<<<<
A4B, A5B,
PHPRU\DUUD\LQWKHUHVSHFWLYHEDQN$10VDPSOHGGXULQJD35(&+$5*(FRPPDQGGHWHUPLQHV
$$$$$$
A6B, A7B,
ZKHWKHUWKH35(&+$5*(DSSOLHVWRRQHEDQN$10/2:EDQNVHOHFWHGE\%$>@RUDOOEDQNV
A8B, A9B,
$10+,*+7KHDGGUHVVLQSXWVDOVRSURYLGHWKHRSFRGHGXULQJD/2$'02'(FRPPDQG
A10B /AP,
$GGUHVVLQSXWVDUHUHIHUHQFHGWR9UHI&$$12%&ZKHQHQDEOHGLQWKHPRGHUHJLVWHU05$12
LVVDPSOHGGXULQJ5($'DQG:5,7(FRPPDQGVWRGHWHUPLQHZKHWKHUEXUVWFKRS/2: %&
A11B, A12B /
EXUVWFKRS
BC, A13B,
A14B, A15B
889
BA0B, BA1B, Input Bank Address Inputs: %$>@GHILQHWKHEDQNWRZKLFKDQ$&7,9$7(5($':5,7(RU
35(&+$5*(FRPPDQGLVEHLQJDSSOLHG%$>@GHILQHZKLFKPRGHUHJLVWHU050, MR1, MR2, or
BA2B
MR3LVORDGHGGXULQJWKH/2$'02'(FRPPDQG%$>@DUHUHIHUHQFHGWR9UHI&$
13
CLKBX,
Input Clock: &/.[DQG&/.[DUHGLIIHUHQWLDOFORFNLQSXWVRQHGLIIHUHQWLDOSDLUSHU:25'IRXU:25'V
FRQWDLQHGLQWKH/'[[*SURGXFW$OOFRQWURODQGDGGUHVVLQSXWVLJQDOVDUHVDPSOHGRQWKH
CLKBX#
FURVVLQJRIWKHSRVLWLYHHGJHRI&/.[DQGWKHQHJDWLYHHGJHRI&/.[2XWSXWGDWDVWUREHV
'46['46[LVUHIHUHQFHGWRWKHFURVVLQJRI&/.[DQG&/.[
R13
CKEB
Input Clock Enable: &.(HQDEOHVDQGGLVDEOHVLQWHUQDOFLUFXLWU\DQGFORFNVRQWKH6'5$07KH
VSHFLILFFLUFXLWU\WKDWLVHQDEOHGGLVDEOHGLVGHSHQGHQWXSRQWKH''56'5$0FRQILJXUDWLRQDQG
RSHUDWLQJPRGH7DNLQJ&.(/2:SURYLGHV35(&+$5*(SRZHUGRZQDQG6(/)5()5(6+
RSHUDWLRQVDOOEDQNVLGOHRUDFWLYHSRZHUGRZQURZDFWLYHLQDQ\EDQN&.(LVV\QFKURQRXV
IRUSRZHUGRZQHQWU\DQGH[LWDQGIRUVHOIUHIUHVKHQWU\&.(LVDV\QFKURQRXVIRUVHOIUHIUHVK
H[LW,QSXWEXIIHUVH[FOXGLQJ&/.[&/.[&.(5(6(7DQG2'7DUHGLVDEOHGGXULQJ6(/)
5()5(6+&.(LVUHIHUHQFHGWR9UHI&$
T11
CSB#
Input Chip Select: &6HQDEOHVUHJLVWHUHG/2:DQGGLVDEOHVWKHFRPPDQGGHFRGHU$OOFRPPDQGV
DUHPDVNHGZKHQ&6LVUHJLVWHUHG+,*+&6SURYLGHVIRUH[WHUQDOUDQNVHOHFWLRQRQV\VWHPV
ZLWKPXOWLSOH UDQNV&6LVFRQVLGHUHGSDUWRIWKHFRPPDQGFRGH&6LVUHIHUHQFHGWR9UHI&$
0099
DMxB,
Input Input Data Mask: '0[LVWKHE\WHZLGHGDWDPDVNIRUWKHUHVSHFWLYHELWGDWDILHOGV7KHGDWD
PDVNLQSXWPDVNV:5,7(GDWD%\WHGDWDLVPDVNHGZKHQ'0[LVVDPSOHG+,*+'0[SLQVDUH
VWUXFWXUHGDVLQSXWVRQO\WKHSLQVHOHFWULFDOORDGLQJLVGHVLJQHGWRPDWFKWKDWRIWKH'4'46[
'46[SLQV
N11
RASB#
Input ROW Address Strobe/Select: 'HILQHVWKHFRPPDQGEHLQJHQWHUHGDORQJ&$6:(DQG&6
7KLVLQSXWSLQLVUHIHUHQFHGWR9UHI&$
3
CASB#
Input COLUMN Address Strobe/Select: 'HILQHVWKHFRPPDQGEHLQJHQWHUHGDORQJZLWK5$6:(
DQG&67KLVLQSXWSLQLVUHIHUHQFHGWR9UHI&$
R11
WEB#
Input WRITE Enable Input: 'HILQHVWKHFRPPDQGEHLQJHQWHUHGDORQJZLWK&$65$6DQG&6
7KLVLQSXWSLQLVUHIHUHQFHGWR9UHI&$
LOGIC Devices Incorporated
www.logicdevices.com
10
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 2 - BALL/SIGNAL LOCATION AND DESCRIPTION CONTINUED
Ball Assignments
R12
Symbol
ODTB
Type
Input
Description
On-Die Termination: 2'7HQDEOHVZKHQUHJLVWHUHG+,*+DQGGLVDEOHVWHUPLQDWLRQUHVLVWDQFHLQWHUQDOWRWKH''56'5$0:KHQHQDEOHGLQQRUPDORSHUDWLRQ2'7LVRQO\DSSOLHG
WRHDFKRIWKHIROORZLQJVLJQDOV'4>@'46[DQG'0[7KH2'7LQSXWLVLJQRUHGLI
GLVDEOHGYLDWKH/2$'02'(UHJLVWHUFRPPDQG2'7LVUHIHUHQFHGWR9UHI&$
8
RESETB#
Input
RESET: $QLQSXWFRQWUROSLQDFWLYH/2:UHIHUHQFHGWR9VV7KH5(6(7LQSXWUHFHLYHULV
D&026LQSXWGHILQHGDVDUDLOWRUDLOVLJQDOZLWK'&+,*+t[9DDDQG'&/2:d 0.2 x
9DD45(6(7DVVHUWLRQDQGGHDVVHUWLRQDUHDV\QFKURQRXV
7788
DQSxB,
11<<
DQSxB#
8888::
DQ0B, DQ1B,
::
DQ2B, DQ3B,
Input
Data Strobe, Byte (per WORD): 2XWSXWHGJHDOLJQHGZLWK5($'GDWD,QSXWFHQWHUDOLJQHG
ZLWK:5,7(GDWD
I/O
Data Input/Output: /2:%\WH/2::25':25'3LQUHIHUHQFHGWR9UHI'4
I/O
Data Input/Output: +,*+%\WH/2::25':25'3LQUHIHUHQFHGWR9UHI'4
I/O
Data Input/Output: /2:%\WH:25'3LQUHIHUHQFHGWR9UHI'4
I/O
Data Input/Output: +,*+%\WH:25'3LQUHIHUHQFHGWR9UHI'4
DQ4B, DQ5B,
DQ6B, DQ7B
:::<<<
DQ8B, DQ9B,
<<
DQ10B, DQ11B,
DQ12B, DQ13B,
DQ14B, DQ15B
333377 DQ16B, DQ17B,
77
DQ18B, DQ19B,
DQ20B, DQ21B,
DQ22B, DQ23B
//1111 DQ24B, DQ25B,
33
DQ26B, DQ27B,
DQ28B, DQ29B,
DQ30B, DQ31B
M9
VSSDLLB
*URXQGIRU'//
N9
VDDDLLB
6XSSO\IRU'//
T10
VrefCAB
Supply 9ROWDJH5HIHUHQFH&25(9UHI&$PXVWEHPDLQWDLQHGDWDOOWLPHV
3
VrefDAB
Supply 9ROWDJH5HIHUHQFH,29UHI'4PXVWEHPDLQWDLQHGDWDOOWLPHV
LOGIC Devices Incorporated
www.logicdevices.com
11
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 2 - BALL/SIGNAL LOCATION AND DESCRIPTION CONTINUED
Ball Assignments
$%'((
Symbol
VDD
Type
Description
Supply 3RZHU6XSSO\9”9
)*++-
-.///
/0113
35788
9<$$
$$$'''
VDDQ
Supply 'DWD,26XSSO\9”9
')***.
...000
555589
99$$$$$$
$$
$$&()
Vss
Supply Ground
)++--
..////
/0011
33778
:$$$$
$$$$''
'(****
VssQ
Supply 'DWD,2*URXQG,VRODWHGIURP&RUHIRULPSURYHGQRLVHLPPXQLW\
...000
055579
999$$$$
$$
F9, G9, R9, T9
LOGIC Devices Incorporated
RFU
www.logicdevices.com
5HVHUYHGIRU)XWXUH8VH
12
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 5 - MECHANICAL DRAWING
”
”
[120
Ø
”
$
B
&
D
(
F
G
+
K
L
M
N
3
R
T
8
9
:
<
$$
20.00 NOM
1.00 NOM
0$;
1.00 NOM
12.00 NOM
1RWH$OOGLPHQVLRQVLQPP
LOGIC Devices Incorporated
www.logicdevices.com
13
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
L9D3256M32DBG2
L9D3512M32DBG2
PRELIMINARY INFORMATION
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 3: ABSOLUTE MAXIMUM RATINGS
Symbol
MIN
MAX
UNITS
NOTES
9DD
9DD6XSSO\9ROWDJHUHODWLYHWR9VV
Parameter
9
1
9DDQ
9DD6XSSO\9ROWDJHUHODWLYHWR9VVQ
9
1
9IN9287
9ROWDJHRQDQ\SLQUHODWLYHWR9VV
9
1
T$,QGXVWULDO
2SHUDWLQJ$PELHQW7HPSHUDWXUH
85
°&
2,3
T$([WHQGHG
2SHUDWLQJ$PELHQW7HPSHUDWXUH
105
°&
2,3
T$0LOWHPS
2SHUDWLQJ$PELHQW&DVH7HPSHUDWXUH
-55
125
°&
2,3
TSTG
6WRUDJH7HPSHUDWXUH
-55
150
°&
2,3
127(6
9DDDQG9DD4PXVWEHZLWKLQP9RIHDFKRWKHUDWDOOWLPHVDQG95()PXVWQRWEHJUHDWHUWKDQ[9DD4:KHQ9DD and
9DD4DUHOHVVWKDQ0995()PD\EHdP9
0D[RSHUDWLQJDPELHQWWHPSHUDWXUHT$LVPHDVXUHGLQWKHFHQWHURIWKHSDFNDJH
'HYLFH)XQFWLRQDOLW\LVQRWJXDUDQWHHGLIWKH'5$0GHYLFHH[FHHGVWKH0D[LPXP7$GXULQJRSHUDWLRQ
TABLE 4: INPUT/OUTPUT CAPACITANCE
Capacitance Parameter
&.DQG&.?
PACKAGE OUTLINE DIMENSIONS
Symbol
MIN
MAX (256M) MAX (512M)
&&.
1.6
3.2
S)
UNITS
NOTES
6LQJOHHQG,2'4'0
&10
2.2
S)
2
'LIIHUHQWLDO,2'46'46?
&10
2.2
S)
3
1.5
2.8
5.6
S)
5
,QSXWV5$6?&$6?:(?&6?&.(5(6(7?$''5%$
&I_Shared
127(6
9DD 9P999DDQ 9DD95() 9VVI 0+]T$ = 25°&9287'& [9DDQ9287SHDNWRSHDN 9
'0LQSXWLVJURXSHGZLWK,2SLQVUHIOHFWLQJWKHVLJQDOLVJURXSHGZLWK'4DQGWKHUHIRUHPDWFKHGLQORDGLQJ
&&&46LVIRU'46YV'46?
&DIO &,2'4[&,2>'[email protected]&,2>'[email protected]
([FOXGHV&.&.?
&',B&17/ &,&17/[&&.>&[email protected]&&.>&[email protected]&17/ 2'7&6?DQG&.(
&',B&0'B$''5 &,&0'B$''5[&&.>&[email protected]&&.>&[email protected]&0' 5$6?&$6?DQG:(?$''5 >[email protected]
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 5: TIMING PARAMETERS FOR IDD MEASUREMENTS - CLOCK UNITS
IDD Parameter
DDR3-1333
DDR3-1600
DDR3-1866
-15
-12
-11
10-10-10
11-11-11
13-13-13
t&.0,1,DD
1.5
1.25
QV
&/,DD
10
11
13
&.
t5&'0,1,DD
10
11
13
&.
W5&0,1,DD
39
&.
t5$60,1,DD
28
32
&.
10
11
13
&.
30
32
33
&.
t530,1,DD
t)$:
[
tRRD IDD
[
t5)&
LOGIC Devices Incorporated
5
6
6
&.
208
&.
www.logicdevices.com
15
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
ODT
WE\
CAS\
RAS\
Sub-Loop
CKE
www.logicdevices.com
1
2
3
4
5
6
7
BA [2:0]
Cycle
Number
0
A [15:11]
PRE
A [10]
0
1
1
1
1
A [9:7]
ACT
D
D
D\
D\
0
PRE
A [6:3]
1
1
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
1
1
0
0
0
0
0
0
1
1
0
0
0
0
0
0
Repeat cycles 1 through 4 until n RAS - 1, truncate if needed
0
1
0
0
0
0
0
0
0
Repeat cycles 1 through 4 until n RC - 1, truncate if needed
0
1
1
0
0
0
0
0
F
0
0
0
0
0
0
0
0
F
0
0
0
0
0
0
0
0
F
1
1
1
0
0
0
0
0
F
1
1
1
0
0
0
0
0
F
Repeat cycles n RC +1 through n RC +4 until n RC - 1 + n RAS - 1, truncate if needed
0
1
0
0
0
0
0
0
F
Repeat cycles n RC +1 through n RC +4 until 2 x RC - 1, truncate if needed
Repeat sub-loop 0, use BA [2:0] = 1
Repeat sub-loop 0, use BA [2:0] = 2
Repeat sub-loop 0, use BA [2:0] = 3
Repeat sub-loop 0, use BA [2:0] = 4
Repeat sub-loop 0, use BA [2:0] = 5
Repeat sub-loop 0, use BA [2:0] = 6
Repeat sub-loop 0, use BA [2:0] = 7
CK, CK\
16
0
0
0
0
0
0
0
0
0
0
0
0
A [2:0]
0
0
0
1
1
-
-
-
-
Data
0
0
1
1
1
1
Command
ACT
D
D
D\
D\
CS\
0
1
2
3
4
n RAS
n RC
n RC + 1
n RC + 2
n RC + 3
n RC + 4
n RC + n RAS
2 x nRC
4 x n RC
6 x n RC
8 x n RC
10 x n RC
12 x n RC
14 x n RC
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 6: IDD0 MEASUREMENT LOOP
Static HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
Cycle
Number
Sub-Loop
CKE
CK, CK\
LOGIC Devices Incorporated
www.logicdevices.com
2 x n RC
2 x n RC
2 x n RC
2 x n RC
2 x n RC
2 x n RC
2 x n RC
Command
1
2
3
4
5
6
7
CS\
0
1
1
1
1
0
0
ACT
D
D
D\
D\
RD
PRE
0
RAS\
PRE
0
1
0
0
0
1
1
0
CAS\
0
WE\
1
ODT
0
BA [2:0]
RD
A [15:11]
1
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
1
0
0
0
0
0
0
1
0
0
0
0
0
0
Repeat cycles 1 through 4 until nRCD - 1, truncate if needed
0
1
0
0
0
0
0
0
Repeat cycles 1 through 4 until nRAS - 1, truncate if needed
1
0
0
0
0
0
0
0
Repeat cycles 1 through 4 until nRC - 1, truncate if needed
1
1
0
0
0
0
0
F
0
0
0
0
0
0
0
F
0
0
0
0
0
0
0
F
1
1
0
0
0
0
0
F
1
1
0
0
0
0
0
F
Repeat cycles nRC + 1 through nRC + 4 until nRC + nRCD - 1, truncate if needed
0
1
0
0
0
0
0
F
Repeat cycles nRC + 1 through nRC + 4 until nRC + nRAS - 1, truncate if needed
1
0
0
0
0
0
0
F
Repeat cycle nRC + 1 through nRC + 4 until 2 x nRC - 1, truncate if needed
Repeat sub-loop 0, use BA [2:0] = 1
Repeat sub-loop 0, use BA [2:0] = 2
Repeat sub-loop 0, use BA [2:0] = 3
Repeat sub-loop 0, use BA [2:0] = 4
Repeat sub-loop 0, use BA [2:0] = 5
Repeat sub-loop 0, use BA [2:0] = 6
Repeat sub-loop 0, use BA [2:0] = 7
A [10]
1
0
0
1
1
A [9:7]
0
0
0
1
1
A [6:3]
0
1
1
1
1
0
0
0
0
0
0
0
0
0
0
0
0
0
0
A [2:0]
ACT
D
D
D\
D\
-
00110011
-
-
00000000
-
Data
0
1
2
3
4
n RCD
n RAS
n RC
n RC +1
nRC +2
n RC +3
n RC +4
n RC + nRCD
n RC + nRAS
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 7: IDD1 MEASUREMENT LOOP
Static HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 8: IDD MEASUREMENT CONDITIONS FOR POWER-DOWN CURRENTS
IDD2P0
IDD2P1
IDD2Q
Precharge Power- Precharge PowerPrecharge Quiet
Down Current
Down Current
Standby Current
(Slow Exit)
(Fast Exit)
Name
7LPLQJ3DWWHUQ
&.(
([WHUQDO&ORFN
IDD3P
Active PowerDown Current
QD
QD
QD
QD
/2:
/2:
+,*+
/2:
Toggling
Toggling
Toggling
Toggling
t&.
t&.0,1,DD
t&.0,1,DD
t&.0,1,DD
t&.0,1,DD
t5&
Q?D
Q?D
Q?D
Q?D
t5$6
Q?D
Q?D
Q?D
Q?D
t5&'
Q?D
Q?D
Q?D
Q?D
tRRD
Q?D
Q?D
Q?D
Q?D
t5&
Q?D
Q?D
Q?D
Q?D
&/
Q?D
Q?D
Q?D
Q?D
$/
Q?D
Q?D
Q?D
Q?D
&6?
+,*+
+,*+
+,*+
+,*+
&RPPDQG,QSXWV
/2:
/2:
/2:
/2:
52:&2/801$GGU
/2:
/2:
/2:
/2:
%DQN$GGUHVV
/2:
/2:
/2:
/2:
DM
/2:
/2:
/2:
/2:
'DWD,2
0LGOHYHO
0LGOHYHO
0LGOHYHO
0LGOHYHO
2XWSXW%XIIHU'4'46
(QDEOHG
(QDEOHG
(QDEOHG
(QDEOHG
(QDEOHG2))
(QDEOHG2))
(QDEOHG2))
(QDEOHG2))
8
8
8
8
ODT
%XUVW/HQJWK
None
None
None
None
,'/(%DQNV
$OO
$OO
$OO
$OO
6SHFLDO1RWHV
Q?D
Q?D
Q?D
Q?D
$&7,9(%DQNV
LOGIC Devices Incorporated
www.logicdevices.com
18
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
A [15:11]
BA [2:0]
ODT
WE\
CAS\
RAS\
CKE
CK, CK\
www.logicdevices.com
0
0
0
0
0
0
F
F
0
1
2
3
4
5
6
7
D
D
D\
D\
Cycle
Number
Sub-Loop
LOGIC Devices Incorporated
0
0
0
0
Command
0
1
2
3
4-7
8-11
12-15
16-19
20-23
24-27
28-31
CS\
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
Repeat sub-loop 0, use BA [2:0] = 1
Repeat sub-loop 0, use BA [2:0] = 2
Repeat sub-loop 0, use BA [2:0] = 3
Repeat sub-loop 0, use BA [2:0] = 4
Repeat sub-loop 0, use BA [2:0] = 5
Repeat sub-loop 0, use BA [2:0] = 6
Repeat sub-loop 0, use BA [2:0] = 7
A [10]
0
0
1
1
A [9:7]
0
0
1
1
A [6:3]
0
0
1
1
A [2:0]
1
1
1
1
Data
-
TABLE 9: IDD2N / IDD3N MEASUREMENT LOOP
Static HIGH
Toggling
19
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
D
D
D\
D\
A [15:11]
BA [2:0]
ODT
WE\
CAS\
RAS\
CS\
Sub-Loop
CKE
0
0
0
0
0
0
0
0
0
0
1
0
0
0
0
1
0
0
0
0
Repeat sub-loop 0, use BA [2:0] = 1; ODT = 0
Repeat sub-loop 0, use BA [2:0] = 2; ODT = 1
Repeat sub-loop 0, use BA [2:0] = 3; ODT = 1
Repeat sub-loop 0, use BA [2:0] = 4; ODT = 0
Repeat sub-loop 0, use BA [2:0] = 5; ODT = 0
Repeat sub-loop 0, use BA [2:0] = 6; ODT = 1
Repeat sub-loop 0, use BA [2:0] = 7; ODT = 1
A [10]
0
0
1
1
0
0
0
0
A [9:7]
0
0
1
1
0
0
F
F
A [6:3]
1
1
1
1
0
0
0
0
A [2:0]
1
2
3
4
5
6
7
Command
Cycle
Number
0
1
2
3
4-7
8-11
12-15
16-19
20-23
24-27
28-31
-
Data
0
PRELIMINARY INFORMATION
CK, CK\
20
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 10: IDD2NT MEASUREMENT LOOP
Static HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
BA [2:0]
ODT
WE\
CAS\
RAS\
CS\
Sub-Loop
CKE
CK, CK\
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
Repeat sub-loop 0, use BA [2:0] = 1
Repeat sub-loop 0, use BA [2:0] = 2
Repeat sub-loop 0, use BA [2:0] = 3
Repeat sub-loop 0, use BA [2:0] = 4
Repeat sub-loop 0, use BA [2:0] = 5
Repeat sub-loop 0, use BA [2:0] = 6
Repeat sub-loop 0, use BA [2:0] = 7
A [15:11]
1
0
1
1
1
0
1
1
A [10]
0
0
1
1
0
0
1
1
0
0
0
0
0
0
0
0
A [9:7]
1
0
1
1
1
0
1
1
0
0
0
0
F
F
F
F
A [6:3]
0
1
1
1
0
1
1
1
0
0
0
0
0
0
0
0
A [2:0]
1
2
3
4
5
6
7
RD
D
D\
D\
RD
D
D\
D\
00000000
00110011
-
Data
0
Command
Cycle
Number
0
1
2
3
4
5
6
7
8-15
16-23
24-31
32-39
40-47
48-55
56-63
PRELIMINARY INFORMATION
21
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 11: IDD4R MEASUREMENT LOOP
Static HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
BA [2:0]
ODT
WE\
CAS\
RAS\
CS\
Sub-Loop
CKE
CK, CK\
1
0
0
1
0
0
1
0
0
1
0
0
1
0
0
1
0
0
1
0
0
1
0
0
Repeat sub-loop 0, use BA [2:0] = 1
Repeat sub-loop 0, use BA [2:0] = 2
Repeat sub-loop 0, use BA [2:0] = 3
Repeat sub-loop 0, use BA [2:0] = 4
Repeat sub-loop 0, use BA [2:0] = 5
Repeat sub-loop 0, use BA [2:0] = 6
Repeat sub-loop 0, use BA [2:0] = 7
A [15:11]
0
0
1
1
0
0
1
1
0
0
0
0
0
0
0
0
A [10]
0
0
1
1
0
0
1
1
0
0
0
0
0
0
0
0
A [9:7]
1
0
1
1
1
0
1
1
0
0
0
0
F
F
F
F
A [6:3]
0
1
1
1
0
1
1
1
0
0
0
0
0
0
0
0
A [2:0]
1
2
3
4
5
6
7
WR
D
D\
D\
WR
D
D\
D\
00000000
00110011
-
Data
0
Command
Cycle
Number
0
1
2
3
4
5
6
7
8-15
16-23
24-31
32-39
40-47
48-55
56-63
PRELIMINARY INFORMATION
22
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 12: IDD4W MEASUREMENT LOOP
Stac HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
REF
D
D
D\
D\
Cycle
Number
0
1
2
3
4
5-8
9-12
13-16
17-20
21-24
25-28
29-32
33-n RFC-1
Sub-Loop
CKE
CK, CK\
1b
1c
1d
1e
1f
1g
1h
2
1a
Command
0
A [9:7]
A [10]
A [15:11]
BA [2:0]
ODT
WE\
CAS\
Repeat sub-loop 1a, use BA [2:0] = 1
Repeat sub-loop 1a, use BA [2:0] = 2
Repeat sub-loop 1a, use BA [2:0] = 3
Repeat sub-loop 1a, use BA [2:0] = 4
Repeat sub-loop 1a, use BA [2:0] = 5
Repeat sub-loop 1a, use BA [2:0] = 6
Repeat sub-loop 1a, use BA [2:0] = 7
Repeat sub-loop 1a through 1h until
n RFC - 1, truncate if needed
PRELIMINARY INFORMATION
23
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 13: IDD5B MEASUREMENT LOOP
Data
A [2:0]
A [6:3]
RAS\
CS\
Static HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
PACKAGE OUTLINE DIMENSIONS
TABLE 14: IDD MEASUREMENT LOOP
,QGXVWULDO5DQJH ([WHQGHGRU0LO7HPSHUDWXUH5DQJH
T$ “&WR“&
T$ “&WR“&RU“&WR“&
IDD6: Self Refresh
Current
IDD6E/M: Self Refresh
Current
IDD8: Reset
&.(
/2:
/2:
0LGOHYHO
([WHUQDO&ORFN
2II&.DQG&.? /2:
2II&.DQG&.? /2:
0LGOHYHO
t&.
Q?D
Q?D
Q?D
IDD Test
t5&
Q?D
Q?D
Q?D
t5$6
Q?D
Q?D
Q?D
t5&'
Q?D
Q?D
Q?D
tRRD
Q?D
Q?D
Q?D
t5&
Q?D
Q?D
Q?D
&/
Q?D
Q?D
Q?D
$/
Q?D
Q?D
Q?D
&6?
0LGOHYHO
0LGOHYHO
0LGOHYHO
&RPPDQG,QSXWV
0LGOHYHO
0LGOHYHO
0LGOHYHO
52:&2/081DGGUHVVHV
0LGOHYHO
0LGOHYHO
0LGOHYHO
%$1.DGGUHVVHV
0LGOHYHO
0LGOHYHO
0LGOHYHO
'DWD,2
0LGOHYHO
0LGOHYHO
0LGOHYHO
2XWSXWEXIIHU'4'46
(QDEOHG
(QDEOHG
0LGOHYHO
ODT
(QDEOHG0LGOHYHO
(QDEOHG0LGOHYHO
0LGOHYHO
%XUVW/HQJWK
Q?D
Q?D
Q?D
$FWLYH%$1.6
Q?D
Q?D
None
,'/(%$1.6
Q?D
Q?D
$OO
SRT
'LVDEOHGQRUPDO
(QDEOHGH[WHQGHG
Q?D
$65
'LVDEOHG
'LVDEOHG
Q?D
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
Sub-Loop
CKE
www.logicdevices.com
CK, CK\
25
19
15
16
17
18
14
12
13
11
10
9
5
6
7
8
Cycle
Number
0
0
1
ACT
RDA
D
D
1
1
0
0
1
ACT
RDA
D
D
1
D
RAS\
1
0
0
0
1
0
0
1
0
0
0
CAS\
D
WE\
0
1
0
ODT
4
0
0
1
ACT
RDA
D
BA [2:0]
0
0
0
0
0
0
0
0
1
0
0
0
0
0
0
Repeat cycle 2 until n RRD - 1
1
1
0
1
0
0
0
0
1
0
1
0
1
0
0
0
0
1
0
0
0
Repeat cycle n RRD + 2 until 2 x n RRD - 1
Repeat sub-loop 0, use BA[2:0] = 2
Repeat sub-loop 0, use BA[2:0] = 3
0
0
0
3
0
0
0
Repeat cycle 4 x n RRD until n FAW - 1, if needed
Repeat sub-loop 0, use BA[2:0] = 4
Repeat sub-loop 1, use BA[2:0] = 5
Repeat sub-loop 0, use BA[2:0] = 6
Repeat sub-loop 1, use BA[2:0] = 7
0
0
0
7
0
0
0
Repeat cycle n FAW + 4 x n RRD until 2 x n FAW - 1, if needed
1
1
0
0
0
0
0
0
1
0
0
0
1
0
0
0
0
0
0
0
0
Repeat cycle 2 x n FAW + 2 until 2 x n FAW + n RRD - 1
1
1
0
1
0
0
0
0
1
0
1
0
1
0
0
0
0
1
0
0
0
Repeat cycle 2 x n FAW + n RRD + 2 until 2 x n FAW + 2 x n RRD - 1
Repeat sub-loop 10, use BA[2:0] = 2
Repeat sub-loop 11, use BA[2:0] = 3
0
0
0
3
0
0
0
Repeat cycle 2 x n FAW + 4 x n RRD until 3 x n FAW - 1, if needed
Repeat sub-loop 10, use BA[2:0] = 4
Repeat sub-loop 11, use BA[2:0] = 5
Repeat sub-loop 10, use BA[2:0] = 6
Repeat sub-loop 11, use BA[2:0] = 7
0
0
0
7
0
0
0
Repeat cycle 3 x n FAW + 4 x n RRD until 4 x n FAW - 1, if needed
A [15:11]
1
1
0
A [10]
1
0
0
A [9:7]
0
1
0
0
0
0
0
0
F
F
F
F
F
F
F
F
0
0
0
A [6:3]
2
3
0
0
1
Command
ACT
RDA
D
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
0
A [2:0]
1
CS\
0
1
2
3
n RRD
n RRD + 1
n RRD + 2
n RRD + 3
2 x n RRD
3x n RRD
4 x n RRD
4 x n RRD + 1
n FAW
n FAW + n RRD
n FAW + 2xn RRD
n FAW + 3xn RRD
n FAW + 4xn RRD
n FAW + 4xn RRD+1
2 x n FAW
2 x n FAW + 1
2 x n FAW + 2
2 x n FAW + 3
2 x n FAW + n RRD
2 x n FAW + n RRD+1
2 x n FAW + n RRD+2
2 x n FAW + n RRD+3
2 x nFAW + 2x n RRD
2 x n FAW + 3x n RRD
2 x n FAW + 4x n RRD
2 x n FAW+4x n RRD+1
3 x nFAW
3 x nFAW + nRRD
3 x nFAW + 2x nRRD
3 x nFAW + 3x nRRD
3 x nFAW + 4x nRRD
3 x nFAW + 4x nRRD +1
-
00000000
-
00110011
-
-
-
00110011
-
00000000
-
Data
0
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 15: IDD7 MEASUREMENT LOOP
Static HIGH
Toggling
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 16A: IDD MAXIMUM LIMITS (256M)
Speed Bin
IDD
DDR3-1333
DDR3-1600
DDR3-1866
UNITS
IDD0
IDD1
IDD3
IDD3
IDD2Q
IDD2N
IDD3
IDD3N
IDD5
IDD:
IDD5B
IDD6
IDD
IDD8
320
80
128
200
232
292
960
800
88
IDD3P$
IDD3P$
IDD3P$
360
80
188
220
252
308
1120
900
880
88
IDD3P$
IDD3P$
IDD3P$
80
168
208
328
1200
1000
920
88
1280
IDD3P$
IDD3P$
IDD3P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
IND
(;7
0,/7(03
127(6T$ = 0°&WRd 85°&657DQG$65DUHGLVDEOHGHQDEOLQJ$65FRXOGLQFUHDVH,DD[E\XSWRDQDGGLWLRQDOP$
TABLE 16B: IDD MAXIMUM LIMITS (512M)
Speed Bin
IDD
DDR3-1333
DDR3-1600
DDR3-1866
UNITS
IDD0
IDD1
IDD3
IDD3
IDD2Q
IDD2N
IDD3
IDD3N
IDD5
IDD:
IDD5B
IDD6
IDD
IDD8
880
160
256
352
1920
1600
1680
2080
IDD3P$
IDD3P$
IDD3P$
920
160
296
616
1800
2280
IDD3P$
IDD3P$
IDD3P$
800
960
160
336
656
2000
2560
IDD3P$
IDD3P$
IDD3P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
P$
IND
(;7
0,/7(03
127(6T$ = 0°&WRd 85°&657DQG$65DUHGLVDEOHGHQDEOLQJ$65FRXOGLQFUHDVH,DD[E\XSWRDQDGGLWLRQDOP$
LOGIC Devices Incorporated
www.logicdevices.com
26
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 17: DC ELECTRICAL CHARACTERISTICS AND OPERATINGPC
ONDITIONS
ACKAGE
OUTLINE DIMENSIONS
$OO9ROWDJHVDUHUHIHUHQFHGWR9VV
Parameter/Condition
Supply Voltage
I/O Supply Voltage
Input Leakage Current:
Symbol
MIN
TYP
MAX
UNITS
NOTES
9DD
1.2825
1.35
9
1,2
9DDQ
1.2825
1.35
9
1,2
II
-
˜$
I95()
-
˜$
$Q\LQSXW9d9INd9DD95()SLQ9d9INd9
$OORWKHUSLQVQRWXQGHUWHVW 9
VREF Supply Leakage Current:
95()'4 9DDRU95()&$ 9DD
$OORWKHUSLQVQRWXQGHUWHVW 9
127(6
1.
9DDDQG9DD4PXVWWUDFNRQHDQRWKHU9DD4PXVWEHOHVVWKDQRUHTXDO
3.
95()VHH7DEOH
7KH PLQLPXP OLPLW UHTXLUHPHQW LV IRU WHVWLQJ SXUSRVHV 7KH OHDNDJH
WR9DD9VV 9VV4
2.
9DDDQG9DD4PD\LQFOXGH$&QRLVHRI”P9N+]WR0+]LQ
FXUUHQWRQWKH95()SLQVKRXOGEHPLQLPDO
DGGLWLRQWRWKH'&+]WRN+]VSHFLILFDWLRQV9DDDQG9DD4PXVW
EHDWWKHVDPHOHYHOIRUYDOLG$&WLPLQJSDUDPHWHUV
TABLE 18: DC ELECTRICAL CHARACTERISTICS AND INPUT CONDITIONS
PACKAGE OUTLINE DIMENSIONS
$OO9ROWDJHVDUHUHIHUHQFHGWR9VV
Parameter/Condition
VIN low; DC/commands/address busses
VIN high; DC/commands/address busses
Symbol
MIN
TYP
9IL
9VV
QD
9,+
6HH7DEOH
MAX
UNITS
6HH7DEOH
9
QD
9DD
9
NOTES
Input reference voltage command/address bus
95()&$'&
[9DD
[9DD
[9DD
9
1,2
I/O reference voltage DQ bus
95()'4'&
[9DD
[9DD
[9DD
9
2,3
I/O reference voltage DQ bus in SELF REFRESH
95()'465
9VV
[9DD
9DD
9
9TT
-
[9DDQ
-
9
5
Command/address termination voltage V\VWHPOHYHOQRW
GLUHFW'5$0LQSXW
127(6
1.
95()&$'&LVH[SHFWHGWREHDSSUR[LPDWHO\[9DDDQGWRWUDFNYDUL-
PRQ PRGH RQ 95()'4 PD\ QRW H[FHHG ” [ 9DD around the
DWLRQVLQWKH'&OHYHO([WHUQDOO\JHQHUDWHGSHDNQRLVHQRQFRPPRQ
95()'4'&YDOXH3HDNWRSHDN$&QRLVHRQ95()'4VKRXOGQRW
PRGHRQ95()&$PD\QRWH[FHHG”[9DDDURXQGWKH95()&$'&
H[FHHG”RI95()'4'&
YDOXH3HDNWRSHDN$&QRLVHRQ95()&$VKRXOGQRWH[FHHG”RI
95()&$'&
95()'4'& PD\ WUDQVLWLRQ WR 95()'465 DQG EDFN WR 95()'4'&
ZKHQ LQ 6(/) ]5()5(6+ ZLWKLQ UHVWULFWLRQV RXWOLQHG LQ WKH 6(/)
2.
'&YDOXHVDUHGHWHUPLQHGWREHOHVVWKDQ0+]LQIUHTXHQF\'5$0
5()5(6+VHFWLRQ
PXVW PHHW VSHFLILFDWLRQV LI WKH '5$0 LQGXFHV DGGLWLRQDO $& QRLVH
JUHDWHUWKDQ0+]LQIUHTXHQF\
5.
9TT LV QRW DSSOLHG GLUHFWO\ WR WKH GHYLFH 9TT LV D V\VWHP VXSSO\ IRU
VLJQDOWHUPLQDWLRQUHVLVWRUV0,1DQG0$;YDOXHVDUHV\VWHPGHSHQ-
3.
95()'4'& LV H[SHFWHG WR EH DSSUR[LPDWHO\ [ 9DD DQG WR WUDFN
dent.
YDULDWLRQVLQWKH'&OHYHO([WHUQDOO\JHQHUDWHGSHDNQRLVHQRQFRP-
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 19: INPUT SWITCHING CONDITIONS
PACKAGE OUTLINE DIMENSIONS
Symbol
DDR3-1333
DDR3-1600
9,+$&0,1
Input high AC voltage: Logic 1
9,+$&0,1
Input high DC voltage: Logic 1
9,+'&0,1
Input high DC voltage: Logic 0
Input high AC voltage: Logic 0
Input high AC voltage: Logic 0
Parameter/Condition
DDR3-1866
UNITS
&RPPDQGDQG$GGUHVV
Input high AC voltage: Logic 1
-
P9
-
P9
P9
9,/'&0$;
-100
-100
P9
9,/$&0$;
-150
-
P9
9,/$&0$;
-
P9
DQ and DM
Input high AC voltage: Logic 1
9,+$&0,1
-
-
P9
Input high AC voltage: Logic 1
9,+$&0,1
-
P9
Input high DC voltage: Logic 1
9,+'&0,1
P9
Input high DC voltage: Logic 0
9,/'&0$;
-100
-100
P9
Input high AC voltage: Logic 0
9,/$&0$;
-150
-
P9
Input high AC voltage: Logic 0
9,/$&0$;
-
-
P9
127(6
1.
$OOYROWDJHVDUHUHIHUHQFHGWR95()95()LV95()&$IRUFRQWUROFRP-
3.
PDQGDQGDGGUHVV$OOVOHZUDWHVDQGVHWXSKROGWLPHVDUHVSHFLILHGDW
,QSXWKROGWLPLQJSDUDPHWHUVt,+DQG t'+DUHUHIHUHQFHGDW9IL'&
9,+'&QRW95()$&
WKH'5$0EDOO95()LV95()'4IRU'4DQG'0LQSXWV
2.
,QSXWVHWXSWLPLQJSDUDPHWHUVtIS and t'6DUHUHIHUHQFHGDW9IL$&
6LQJOHHQGHG LQSXW VOHZ UDWH 9QV PD[LPXP LQSXW YROWDJH VZLQJ
XQGHUWHVWLVP9SHDNWRSHDN
9,+$&QRW95()'&
LOGIC Devices Incorporated
www.logicdevices.com
28
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OPERATING CONDITIONS
FIGURE 6 - INPUT SIGNAL
VIL and VIH levels with ringback
1.90V
VDDQ + 0.4V narrow pulse width
1.50V
VDDQ
Minimum VIL and VIH levels
VIH (AC)
0.925V
0.925V
VIH (AC)
VIH (DC)
VIH (DC)
0.850V
0.850V
0.780V
0.765V
0.750V
0.735V
0.720V
0.780V
0.765V
0.750V
0.735V
0.720V
VREF + AC noise
VREF + DC error
VREF + DC error
VREF + AC noise
0.650V
VIL (DQ)
0.575V
VIL (AC)
0.650V
VIL (DC)
0.575V
VIL (AC)
VSS
0.0V
VSS 0.4V narrow pulse width
-0.40V
Notes:
LOGIC Devices Incorporated
www.logicdevices.com
1. Numbers in diagrams reflect nominal values.
29
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
AC OVERSHOOT/UNDERSHOOT SPECIFICATION
TABLE 20: CONTROL AND ADDRESS PINS
PACKAGE OUTLINE DIMENSIONS
Parameter
DDR3-1333
DDR3-1600
DDR3-1866
9
9
9
9
9
9
Maximum overshoot area above Vcc VHH)LJXUH
9QV
9QV
9QV
Maximum undershoot area below Vss VHH)LJXUH
9QV
9QV
9QV
Maximum peak amplitude allowed for overshoot area
VHH)LJXUH
Maximum peak amplitude allowed for undershoot area
VHH)LJXUH
TABLE 21: CLOCK, DATA, STROBE, AND MASK PINS
PACKAGE OUTLINE DIMENSIONS
Parameter
DDR3-1333
Maximum peak amplitude allowed for overshoot area
DDR3-1600
DDR3-1866
9
9
9
9
9
9
9QV
9QV
9QV
9QV
9QV
9QV
VHH)LJXUH
Maximum peak amplitude allowed for undershoot area
VHH)LJXUH
Maximum overshoot area above Vcc/ VccQ
VHH)LJXUH
Maximum undershoot area below Vss/ VssQ
VHH)LJXUH
FIGURE 7 & 8: OVERSHOOT/UNDERSHOOT SPECIFICATIONS
Maximum amplitude
Volts (V)
Figure 7: Overshoot
Overshoot area
VDD/VDDQ
Time (ns)
Time (ns)
Figure 8: Undershoot
VSS/VSSQ
Volts (V)
Maximum amplitude
LOGIC Devices Incorporated
www.logicdevices.com
30
Undershoot area
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 22: DIFFERENTIAL INPUT OPERATING CONDITIONS (CKXP, ACKAGE
CKX\, DQS
X, AND
DQSX\)
OUTLINE
DIMENSIONS
Parameter/Condition
Symbol
MIN
MAX
UNITS
NOTES
Differential input voltage, logic high - slew
9,+',))$&VOHZ
QD
P9
Differential input voltage, logic low - slew
9IL ',))$&VOHZ
QD
-200
P9
Differential input voltage, logic high
9,+',))$&
[9,+$&95()
9DD9DDQ
P9
5
Differential input voltage, logic low
9IL ',))$&
9VV9VVQ
[95()9IL$&
P9
6
9,;
95()'&
95()'&
P9
9,;
95()'&
95()'&
P9
96+(
9DD49,+$&
9DDQ
P9
5
9DD9,+$&
9DD
9VVQ
9DD49IL$&
P9
6
9VV
9DD-9IL$&
Differential input crossing voltage relative to VDD/2
for DQS, DQS\, CK, CK\
Differential input crossing voltage relative to VDD/2
for CK, CK\
Single-ended high level for strobes
Single-ended high level for CK, CK\
Single-ended low level for strobes
96(/
Single-ended low level for CK, CK\
127(6
1.
&ORFN LV UHIHUHQFHG WR 9DD' DQG 9VV 'DWD VWUREH LV UHIHUHQFHG WR
6.
9DD4DQG9VV4
2.
0,1OLPLWLVUHODWLYHWRVLQJOHHQGHGVLJQDOVWKHXQGHUVKRRWVSHFLILFDWLRQVDUHDSSOLFDEOH
5HIHUHQFHLV95()&$'&IRUFORFNDQGIRU95()'4'&IRUVWUREH
7KHW\SLFDOYDOXHRI9,;$&LVH[SHFWHGWREHDERXW[9DDRIWKH
WUDQVPLWWLQJGHYLFHDQG9,;$&LVH[SHFWHGWRWUDFNYDULDWLRQVLQ9DD.
3.
'LIIHUHQWLDOLQSXWVOHZUDWH 9PV
9,;$& LQGLFDWHV WKH YROWDJH DW ZKLFK GLIIHUHQWLDO LQSXW VLJQDOV PXVW
FURVV
'HILQHVVOHZUDWHUHIHUHQFHSRLQWVUHODWLYHWRLQSXWFURVVLQJYROWDJHV
5.
0$; OLPLW LV UHODWLYH WR VLQJOHHQGHG VLJQDOV WKH RYHUVKRRW VSHFLILFD-
9,;H[WHQGHGUDQJHLVRQO\DOORZHGZKHQWKHIROORZLQJFRQGLWLRQVDUH
WLRQVDUHDSSOLFDEOH
PHW7KHVLQJOHHQGHGLQSXWVLJQDOVDUHPRQRWRQLFKDYHWKHVLQJOH
8.
7KH9,;H[WHQGHGUDQJH”P9LVDOORZHGRQO\IRUWKHFORFNDQGWKLV
HQGHGVZLQJ96(/96(+RIDWOHDVW9DD”P9DQGWKHGLIIHUHQWLDO
VOHZUDWHRI&.&.?LVJUHDWHUWKDQ9QV
LOGIC Devices Incorporated
www.logicdevices.com
31
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OVERSHOOT/UNDERSHOOT SPECIFICATIONS
FIGURE 9 - VIX FOR DIFFERENTIAL SIGNALS
VDD, VDDQ
VDD, VDDQ
CK#, DQS#
CK#, DQS#
VIX
X
VIX
VDD/2, VDDQ/2
X
VDD/2, VDDQ/2
X
VIX
VIX
X
CK, DQS
CK, DQS
VSS, VSSQ
VSS, VSSQ
FIGURE 10 - SINGLE-ENDED REQUIREMENTS FOR DIFFERENTIAL SIGNALS
V DD or VDD Q
VSEH (MIN)
V DD /2 or VDD Q/2
VSEH
CK or DQS
VSEL (MAX)
VSEL
VSS or VSS Q
LOGIC Devices Incorporated
www.logicdevices.com
32
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OVERSHOOT/UNDERSHOOT SPECIFICATIONS
FIGURE 11 - DEFINITION OF DIFFERENTIAL AC-SWING AND tDVAC
t DVAC
V IHDIFF ( A C) MIN
V IHDIFF (MIN)
V IHDIFF ( DC) MIN
CK - CK#
DQ S - DQS #
0.0
V ILDIFF ( DC) MAX
V ILDIFF (MAX)
V ILDIFF ( A C) MAX
t DVAC
half cycle
TABLE 23: DIFFERENTIAL INPUT OPERATING CONDITIONS (tDVAC)
FOR CK
X, CKD
X\,
DQSX, AND DQSX\
PACKAGE
OUTLINE
IMENSIONS
%HORZ9IL$&
tDVAC (ps) at [VIHDIFF(AC) to VILDiff(AC)]
LOGIC Devices Incorporated
Slew Rate (V/ns)
350mV
300mV
-4.0
4.0
3.0
50
2.0
38
163
1.9
162
1.6
29
161
1.4
22
159
1.2
13
155
1.0
0
150
<1.0
0
150
www.logicdevices.com
33
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SLEW RATE DEFINITIONS FOR SINGLE-ENDED INPUT SIGNALS
+ROGt,+DQGt'+QRPLQDOVOHZUDWHIRUDULVLQJVLJQDOLVGHILQHGDVWKHVOHZ
UDWHEHWZHHQWKHODVWFURVVLQJRI9IL'&0$;DQGWKHILUVWFURVVLQJRI95().
+ROGt,+DQGt'+QRPLQDOVOHZUDWHIRUDIDOOLQJVLJQDOLVGHILQHGDVWKHVOHZ
UDWHEHWZHHQWKHODVWFURVVLQJRI9,+'&0,1DQGWKHILUVWFURVVLQJRI95().
6HWXS tIS and t'6 QRPLQDO VOHZ UDWH IRU D ULVLQJ VLJQDO LV GHILQHG DV WKH
VOHZUDWHEHWZHHQWKHODVWFURVVLQJRI95()DQGWKHILUVWFURVVLQJ9,+$&
0,1 6HWXS tIS and t'6 QRPLQDO VOHZ UDWH IRU D IDOOLQJ VLJQDO LV GHILQHG
DVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI95()DQWKHILUVWFURVVLQJRI
9IL$&0$;
TABLE 24: SINGLE-ENDED INPUT SLEW RATE
Measured
Input Slew Rate (Linear Signals)
Input
PACKAGE OUTLINE DIMENSIONS
Edge
From
To
5LVLQJ
95()
9,+$&0,1
Falling
95()
9IL$&0$;
5LVLQJ
9IL'&0D[
95()
Setup
Calculation
9,+$&0,195()
95()9IL$&0$;
'TFS
95()9IL'&0$;
'7)+
Hold
Falling
9,+'&0,1
95()
9,+'&0,195()
'756+
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SLEW RATE DEFINITIONS FOR SINGLE-ENDED INPUT SIGNALS
FIGURE 12 - NOMINAL SLEW RATE DEFINITION FOR SINGLE-ENDED INPUT SIGNALS
ΔTRS
Setup
Single-ended input voltage (DQ, CMD, ADDR)
VIH(AC) MIN
VIH(DC) MIN
VREFDQ or
VREFCA
VIL(DC) MAX
VIL(AC) MAX
ΔTFS
ΔTRH
Hold
Single-ended input voltage (DQ, CMD, ADDR)
VIH(AC) MIN
VIH(DC) MIN
VREFDQ or
VREFCA
VIL(DC) MAX
VIL(AC) MAX
ΔTFH
LOGIC Devices Incorporated
www.logicdevices.com
35
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SLEW RATE DEFINITIONS FOR DIFFERENTIAL INPUT SIGNALS
,QSXWVOHZUDWHIRUGLIIHUHQWLDOVLJQDOV&.[&.[?8'46[8'46[?/'46[DQG/'46[?DUHGHILQHGDQGPHDVXUHGDVVKRZQLQ7DEOH7KHQRPLQDOVOHZ
UDWHIRUDULVLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQ9IL',))0$;DQG9,+',))0,17KHQRPLQDOVOHZUDWHIRUDIDOOLQJVLJQDOLVGHILQHGDVWKHVOHZ
UDWHEHWZHHQ9,+',))0,1DQG9IL',))0$;
TABLE 25: DIFFERENTIAL INPUT SLEW RATE DEFINITION
Measured
Input Slew Rate (Linear Signals)
Input
Edge
PACKAGE OUTLINE DIMENSIONS
From
5LVLQJ
95()
To
Calculation
9,+',))0,1- 9IL',))0$;
9,+$&0,1
'75',))
CK and DQS
Reference
9,+',))0,1 9IL',))0$;
Falling
95()
9,/$&0$;
'7)',))
FIGURE 13 - NOMINAL DIFFERENTIAL INPUT SLEW RATE DEFINITION FOR DQS, DQS# AND CK, CK#
Differential input voltage (DQS, DQS#; CK, CK#)
ΔTR DIFF
VIH(DIFF) MIN
0
VIL(DIFF) MAX
ΔTFDIFF
LOGIC Devices Incorporated
www.logicdevices.com
36
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ODT CHARACTERISTICS
FIGURE 14 - ODT LEVELS AND I-V CHARACTERISTICS
Chip in termination mode
2'7uV HIIHFWLYH UHVLVWDQFH 5TT LV GHILQHG E\ 05> DQG @ 2'7 LV
DSSOLHGWRWKH'4[8'0[/'0[8'46[8'46[?/'46[DQG/'46[?
EDOOV7KH2'7WDUJHWYDOXHVDUHOLVWHGLQ7DEOH
ODT
VDD Q
IPU
IOUT = IPD - IPU
To
other
circuitry
such as
RCV, . . .
RTTPU
DQ
IOUT
R TTPD
VOUT
IPD
VSSQ
TABLE 26: ON-DIE TERMINATION DC ELECTRICAL CHARACTERISTICS
Parameter/Condition
Symbol
RTTHIIHFWLYHLPSHGDQFH
RTTB())
'HYLDWLRQRI90ZLWKUHVSHFWWR9DD4
'90
MIN
TYP
MAX
UNITS
NOTES
6HH7DEOH
-5
5
127(6
1.
7ROHUDQFH OLPLWV DUH DSSOLFDEOH DIWHU D SURSHU =4 FDOLEUDWLRQ KDV EHHQ
3.
0HDVXUHYROWDJH90DWWKHWHVWHGSLQZLWKQRORDG
SHUIRUPHGDWDVWDEOHWHPSHUDWXUHDQGYROWDJH9DD4 9DD9VV49VV
5HIHUWRv2'76HQVLWLYLW\wRQSDJHLIHLWKHUWKHWHPSHUDWXUHRUYROWDJH
'90
FKDQJHVDIWHUFDOLEUDWLRQ
2.
[90
-1 x 100
9DDQ
0HDVXUHPHQWGHILQLWLRQIRU5TT$SSO\9,+$&WRDSLQXQGHUWHVWDQG
PHDVXUHWKHFXUUHQW,>9,+$&@WKHQDSSO\9IL$&WRSLQXQGHUWHVWDQG
)RU H[WHQGHG 0,/WHPS GHYLFHV WKH PLQLPXP YDOXHV DUH GHUDWHG E\
ZKHQWKHGHYLFHLVEHWZHHQ“&DQG“&T$
PHDVXUHFXUUHQW,>9IL$&@
9IL$&9IL$&
RTT =
LOGIC Devices Incorporated
,>9,+$&,9IL$&@
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 27: RTT EFFECTIVE IMPEDANCES
MR1
[9,6,2]
RTT
PACKAGE OUTLINE DIMENSIONS
Resistor
RTT1203'
0, 1, 0
120:
RTT12038
120:
RTT603'120
0, 0, 1
60:
RTT6038
60:
RTT3'80
0, 1, 1
:
RTT3880
:
RTT303'60
1, 0, 1
30:
RTT303860
30:
RTT203'
1, 0, 0
20:
RTT2038
20:
LOGIC Devices Incorporated
www.logicdevices.com
VOUT
MIN
TYP
MAX
UNITS
[9DDQ
0.6
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
9IL$&WR9,+$&
0.9
1.0
1.6
5=4
[9DDQ
0.6
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
9IL$&WR9,+$&
0.9
1.0
1.6
5=4
[9DDQ
0.6
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
9IL$&WR9,+$&
0.9
1.0
1.6
5=4
[9DDQ
0.6
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
9IL$&WR9,+$&
0.9
1.0
1.6
5=4
[9DDQ
0.6
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
5=4
[9DDQ
0.9
1.0
1.1
5=4
[9DDQ
0.9
1.0
1.1
5=4
9IL$&WR9,+$&
0.9
1.0
1.6
5=4
38
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ODT SENSITIVITY
,IHLWKHUWKHWHPSHUDWXUHRUYROWDJHFKDQJHVDIWHU,2FDOLEUDWLRQWKHWROHUDQFHOLPLWVOLVWHGLQ7DEOHFDQEHH[SHFWHGWRZLGHQDFFRUGLQJWR7DEOHVDQG
TABLE 28: ODT SENSITIVITY DEFINITION
Symbol
RTT
MIN
0.9 - dRTTdT x dRTTG9[>'[email protected]
MAX
UNITS
5=4
G5TTG7[>'[email protected][>'[email protected]
TABLE 29 - ODT TEMPERATURE & VOLTAGE SENSITIVITY
Change
MIN
MAX
UNITS
dRTTdT
0
1.5
0
dRTTdV
0
0.15
0
FIGURE 15 - ODT TIMING REFERENCE LOAD
ODT TIMING DEFINITIONS
2'7ORDGLQJGLIIHUVIURPWKDWXVHGLQ$&WLPLQJPHDVXUHPHQWV7ZRSDUDPHWHUVGHILQHZKHQ2'7WXUQVRQRURIIV\QFKURQRXVO\WZRGHILQHZKHQ2'7
WXUQVRQRURII$V\QFKURQRXVO\DQGDQRWKHUGHILQHVZKHQ2'7WXUQVRQRU
RIIG\QDPLFDOO\7DEOHRXWOLQHVDQGSURYLGHVGHILQLWLRQDQGPHDVXUHPHQW
UHIHUHQFHVHWWLQJVIRUHDFKSDUDPHWHU
DUT
CK, CK#
2'7 WXUQRQ WLPH EHJLQV ZKHQ WKH RXWSXW OHDYHV +,*+= DQG 2'7 UHVLVWDQFHEHJLQVWRWXUQRQ2'7WXUQRIIWLPHEHJLQVZKHQWKHRXWSXWOHDYHV
/2:=DQG2'7UHVLVWDQFHEHJLQVWRWXUQRII
VREF
DQ, DM
DQS, DQS#
ZQ
VDDQ/2
RTT = 25Ω
VTT = VSSQ
Timing reference point
RZQ = 240Ω
VSSQ
LOGIC Devices Incorporated
www.logicdevices.com
39
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ODT TIMING DEFINITIONS
TABLE 30: ODT TIMING DEFINITIONS
Symbol
PACKAGE OUTLINE DIMENSIONS
End Point Definition
Figure
5LVLQJHGJHRI&.&.?GHILQHGE\WKHHQGSRLQWRI2'7/RQ
Begin Point Definition
([WUDSRODWHGSRLQWDW9VV4
)LJXUHRQSDJH
tAOF
5LVLQJHGJHRI&.&.?GHILQHGE\WKHHQGSRLQWRI2'7/RII
([WUDSRODWHGSRLQWDW95TT_NORM
)LJXUHRQSDJH
tAONPD
5LVLQJHGJHRI&.&.?ZLWK2'7ILUVWEHLQJUHJLVWHUHG+,*+
([WUDSRODWHGSRLQWDW9VV4
)LJXUHRQSDJH
5LVLQJHGJHRI&.&.?ZLWK2'7ILUVWEHLQJUHJLVWHUHG/2:
([WUDSRODWHGSRLQWDW95TT_NOM
)LJXUHRQSDJH
5LVLQJHGJHRI&.&.?GHILQHGE\WKHHQGSRLQWRI2'7/&1:
([WUDSRODWHGSRLQWVDW95TTB:5DQG95TT_NOM
)LJXUHRQSDJH
tAON
tAOFPD
tADC
2'7/&:1RU2'7/&:1
TABLE 31: REFERENCE SETTINGS FOR ODT TIMING MEASUREMENTS
PACKAGE OUTLINE DIMENSIONS
Measured
Parameter
RTT_NORM Setting
tAON
tAOF
tAONPD
tAOFPD
tADC
VSW1
VSW2
5=4:
RTT_WR_Setting
QD
P9
P9
5=4:
QD
P9
P9
5=4:
QD
P9
P9
5=4:
QD
P9
P9
5=4:
QD
P9
P9
5=4:
QD
P9
P9
5=4:
QD
P9
P9
5=4:
QD
P9
P9
5=4:
5=4:
P9
P9
FIGURE 16 - tAON AND tAOF DEFINITIONS
t AON
t AOF
Begin point: Rising edge of CK - CK#
defined by the end point of ODTL off
Begin point: Rising edge of CK - CK#
defined by the end point of ODTL on
CK
CK
VDDQ/2
CK#
CK#
t AON
t AOF
End point: Extrapolated point at VRTT_NOM
TSW 2
VRTT_NOM
TSW 1
TSW 1
TSW 1
VSW 2
DQ, DM
DQS, DQS#
VSS Q
VSW 2
VSW 1
VSW 1
VSS Q
End point: Extrapolated point at VSS Q
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ODT CHARACTERISTICS
FIGURE 17 - tAONPD AND tAOFPD DEFINITION
t AONPD
t AOFPD
Begin point: Rising edge of CK - CK#
with ODT first registered HIGH
Begin point: Rising edge of CK - CK#
with ODT first registered LOW
CK
CK
VDD Q/2
CK#
CK#
t AONPD
t AOFPD
End point: Extrapolated point at VRTT_NOM
VRTT_NOM
TSW 2
TSW 2
TSW 1
TSW 1
VSW 2
VSW 2
DQ, DM
DQS, DQS#
VSW 1
VSW1
VSS Q
VSS Q
End point: Extrapolated point at VSS Q
FIGURE 18 - tADC DEFINITION
Begin point: Rising edge of CK - CK#
defined by the end point of ODTLCNW
Begin point: Rising edge of CK - CK#
defined by the end point of ODTLCNW4 or ODTLCNW8
CK
VDDQ/2
CK#
t ADC
VRTT_NOM
DQ, DM
DQS, DQS#
End point:
Extrapolated
point at VRTT_NOM
t ADC
VRTT_NOM
TSW 21
TSW 11
VSW 2
TSW 22
TSW 12
VSW 1
VRTT_WR
End point: Extrapolated point at VRTT_WR
VSS Q
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OUTPUT DRIVER IMPEDANCE
FIGURE 19 - OUTPUT DRIVER
34 OHM OUTPUT DRIVER IMPEDANCE
7KH:GULYHU05>@ LVWKHGHIDXOWGULYHU8QOHVVRWKHUZLVHVWDWHG
DOOWLPLQJVDQGVSHFLILFDWLRQVOLVWHGKHUHLQDSSO\WRWKH:GULYHURQO\,WV
LPSHGDQFH 5ON LV GHILQHG E\ WKH YDOXH RI WKH H[WHUQDO UHIHUHQFH UHVLVWRU
5=4DVIROORZV5ON 5=4ZLWKQRPLQDO5=4 :”DQGLVDFWXDOO\:”7KH:RXWSXWGULYHULPSHGDQFHFKDUDFWHULVWLFVDUHOLVWHG
LQ7DEOH
Chip in drive mode
Output driver
VDDQ
IPU
To
other
circuitry
such as
RCV, . . .
RONPU
DQ
IOUT
RONPD
IPD
VOUT
VSSQ
TABLE 32: 34: DRIVER IMPEDANCE CHARACTERISTICS
MR1[5,1]
0, 1
RON
PACKAGE OUTLINE DIMENSIONS
RESISTOR
VOUT
MIN
TYP
MAX
UNITS
9DDQ
0.6
1.0
1.1
5=4
1
RON34PD
9DDQ
0.9
1.0
1.1
5=4
1
9DDQ
0.9
1.0
5=4
1
9DDQ
0.9
1.0
5=4
1
9DDQ
0.9
1.0
1.1
5=4
1
9DDQ
0.6
1.0
1.1
5=4
1
9DDQ
-10
QD
10
1, 2
34.3:
RON34PU
Pull-Up/Pull-Down mismatch (MMPUPD)
NOTES
127(6
1.
7ROHUDQFHOLPLWVDVVXPH5=4RI:”DQGDUHDSSOLFDEOHDIWHUSURSHU=4FDOLEUDWLRQKDVEHHQSHUIRUPHGDWDVWDEOHWHPSHUDWXUHDQGYROWDJH
9DD4 9DD9VV4 9VV5HIHUWRv2KPGULYHVHQVLWLYLW\wLIHLWKHUWKHWHPSHUDWXUHRUWKHYROWDJHFKDQJHVDIWHUFDOLEUDWLRQ
2.
0HDVXUHPHQWGHILQLWLRQIRUPLVPDWFKEHWZHHQSXOOXSDQGSXOOGRZQ00383'0HDUXUHERWK52138 and R213'DW[9DDQ:
MM38' =
R2138 - R213'
RONNOM
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
34 OHM OUTPUT DRIVER IMPEDANCE
34 OHM DRIVER
7KH:GULYHUuVFXUUHQWUDQJHKDVEHHQFDOFXODWHGDQGVXPPDUL]HGLQ7DEOHIRU9DD 97DEOHIRU9DD 9DQG7DEOHIRU9DD 9
7KHLQGLYLGXDOSXOOXSDQGSXOOGRZQUHVLVWRUV5213'DQG52138DUHGHILQHGDVIROORZVZLWKWKH,PSHGDQFH&DOFXODWLRQVOLVWHGLQ7DEOH
xRON3' 9287>,[email protected]
xRON38 9DD49287>,[email protected]'LVWXUQHGRII
TABLE 33: 34: DRIVER PULL-UP AND PULL-DOWN IMPEDANCE
CALCULATIONS
PACKAGE
OUTLINE DIMENSIONS
MR1[5,1]
RON
RON
MIN
RZQ = 240:±1%
RZQ = (240:±1%)/7
RESISTOR
RON34PD
0, 1
34.3:
RON34PU
TYP
MAX
UNITS
:
33.9
:
VOUT
MIN
TYP
MAX
9DDQ
38.1
UNITS
:
9DDQ
30.5
38.1
:
9DDQ
30.5
:
9DDQ
30.5
:
9DDQ
30.5
38.1
:
9DDQ
38.1
:
TABLE 34: 34: DRIVER IOH/IOL CHARACTERISTICS: VDD = VPDD
Q = 1.35V
ACKAGE
OUTLINE DIMENSIONS
MR1[5,1]
RON
RESISTOR
RON34PD
0, 1
34.3:
RON34PU
VOUT
MIN
TYP
MAX
UNITS
IOL#[9DDQ
8.8
P$
IOL#[9DDQ
21.9
P$
IOL#[9DDQ
39.3
35
P$
IOL#[9DDQ
39.3
35
P$
IOL#[9DDQ
21.9
P$
IOL#[9DDQ
8.8
P$
TABLE 35: 34: DRIVER IOH/IOL CHARACTERISTICS: VDD=VDD
Q=1.4175V
PACKAGE
OUTLINE DIMENSIONS
MR1[5,1]
RON
RESISTOR
RON34PD
0, 1
34.3:
RON34PU
LOGIC Devices Incorporated
www.logicdevices.com
VOUT
MIN
TYP
IOL#[9DDQ
15.5
9.2
8.3
P$
IOL#[9DDQ
25.8
23
P$
IOL#[9DDQ
36.8
26
P$
IOL#[9DDQ
36.8
26
P$
IOL#[9DDQ
25.8
23
P$
IOL#[9DDQ
15.5
9.2
8.3
P$
MAX
UNITS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
34 OHM OUTPUT DRIVER IMPEDANCE
TABLE 36: 34: DRIVER IOH/IOL CHARACTERISTICS: VDD=VDD
Q=1.2825V
PACKAGE
OUTLINE DIMENSIONS
MR1[5,1]
RON
RESISTOR
RON34PD
0, 1
34.3:
RON34PU
VOUT
MIN
TYP
MAX
UNITS
IOL#[9DDQ
8.3
P$
IOL#[9DDQ
23.3
20.8
P$
IOL#[9DDQ
33.3
23.5
P$
IOL#[9DDQ
33.3
23.5
P$
IOL#[9DDQ
23.3
20.8
P$
IOL#[9DDQ
8.3
P$
34: OUTPUT DRIVER SENSITIVITY
,IHLWKHUWKHWHPSHUDWXUHRUYROWDJHFKDQJHVDIWHU=4FDOLEUDWLRQWKHWROHUDQFHOLPLWVOLVWHGLQ7DEOHFDQEHH[SHFWHGWRZLGHQDFFRUGLQJWR7DEOHDQG
TABLE 37: 34: OUTPUT DRIVER SENSITIVITY DEFINITION
Symbol
MIN
MAX
UNITS
RON @ 0.8 x VDDQ
0.9 - dRONG7+[>'[email protected]+[>'[email protected]
1.1 - dRONG7+[>'[email protected]+[>'[email protected]
5=4
RON @ 0.5 x VDDQ
0.9 - dRONdTM x ['[email protected][>'[email protected]
1.1 - dRONdTM x ['[email protected][>'[email protected]
5=4
RON @ 0.2 x VDDQ
0.9 - dRONdTL x ['[email protected]/[>'[email protected]
1.1 - dRONdTL x ['[email protected]/[>'[email protected]
5=4
TABLE 38: 34: OUTPUT DRIVER VOLTAGE AND TEMPERATURE SENSITIVITY
Change
MIN
MAX
UNITS
dRONdTM
0
1.5
“&
dRONdVM
0
0.13
P9
dRONdTL
0
1.5
“&
dRONdVL
0
0.13
P9
dRONdTH
0
1.5
“&
dRONdVH
0
0.13
P9
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ALTERNATIVE 40 OHM DRIVER
TABLE 39 - 40: DRIVER IMPEDANCE CHARACTERISTICS
MR1[5,1]
0, 1
RON
PACKAGE OUTLINE DIMENSIONS
RESISTOR
VOUT
MIN
TYP
MAX
UNITS
NOTES
9DDQ
0.6
1.0
1.1
5=4
1
RON40PD
9DDQ
0.9
1.0
1.1
5=4
1
9DDQ
0.9
1.0
5=4
1
9DDQ
0.9
1.0
5=4
1
9DDQ
0.9
1.0
1.1
5=4
1
9DDQ
0.6
1.0
1.1
5=4
1
9DDQ
-10
QD
10
1, 2
40.0:
RON40PU
Pull-Up/Pull-Down mismatch (MMPUPD)
127(6
1.
7ROHUDQFHOLPLWVDVVXPH5=4RI:”DQGDUHDSSOLFDEOHDIWHUSURSHU=4FDOLEUDWLRQKDVEHHQSHUIRUPHGDWDVWDEOHWHPSHUDWXUHDQGYROWDJH
9DD4 9DD9VV4 9VV5HIHUWRv2KPGULYHVHQVLWLYLW\wLIHLWKHUWKHWHPSHUDWXUHRUWKHYROWDJHFKDQJHVDIWHUFDOLEUDWLRQ
2.
0HDVXUHPHQWGHILQLWLRQIRUPLVPDWFKEHWZHHQSXOOXSDQGSXOOGRZQ00383'0HDUXUHERWK5ON38DQG5ON3'DW[9DDQ:
MM383' = R2138 - R213'
x 100
RONNOM
40: OUTPUT DRIVER SENSITIVITY
,IHLWKHUWKHWHPSHUDWXUHRUYROWDJHFKDQJHVDIWHU,2FDOLEUDWLRQWKHWROHUDQFHOLPLWVOLVWHGLQ7DEOHFDQEHH[SHFWHGWRZLGHQDFFRUGLQJWR7DEOHDQG
TABLE 40: 40: OUTPUT DRIVER SENSITIVITY DEFINITION
Symbol
MIN
MAX
UNITS
RON @ 0.8 x VDDQ
0.9 - dRONG7+[>'[email protected]+[>'[email protected]
1.1 - dRONG7+[>'[email protected]+[>'[email protected]
5=4
RON @ 0.5 x VDDQ
0.9 - dRONdTM x ['[email protected][>'[email protected]
1.1 - dRONdTM x ['[email protected][>'[email protected]
5=4
RON @ 0.2 x VDDQ
0.9 - dRONdTL x ['[email protected]/[>'[email protected]
1.1 - dRONdTL x ['[email protected]/[>'[email protected]
5=4
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ALTERNATIVE 40 OHM DRIVER
TABLE 41: 40: OUTPUT DRIVER VOLTAGE AND TEMPERATURE SENSITIVITY
Change
MIN
MAX
dRONdTM
0
1.5
UNITS
“&
dRONdVM
0
0.15
P9
dRONdTL
0
1.5
“&
dRONdVL
0
0.15
P9
dRONdTH
0
1.5
“&
dRONdVH
0
0.15
P9
OUTPUT CHARACTERISTICS AND OPERATING CONDITIONS
7KH6'5$0XVHVERWKVLQJOHHQGHGDQGGLIIHUHQWLDORXWSXWGULYHUV7KHVLQJOHHQGHGRXWSXWGULYHULVVXPPDUL]HGLQ7DEOHZKLOHWKHGLIIHUHQWLDORXWSXW
GULYHULVVXPPDUL]HGLQ7DEOH
TABLE 42: SINGLE-ENDED OUTPUT DRIVER CHARACTERISTICS PACKAGE OUTLINE DIMENSIONS
Parameter/Condition
Output leakage current:'4DUHGLVDEOHG
Symbol
MIN
UNITS
NOTES
I2=
-5
MAX
5
X$
1
6546(
2.5
6
9QV
9d9287d9DD42'7LVGLVDEOHG2'7LV+,*+
Output slew rate:6LQJOHHQGHGIRUULVLQJDQGIDOOLQJ
HGJHVPHDVXUHEHWZHHQ9OL$& 95()[9DDQ
DQG92+$& 95()[9DDQ
Single-ended DC high-level output voltage
92+'&
[9DDQ
9
1, 2, 5
Single-ended DC mid-point level output voltage
9OM'&
[9DDQ
9
1, 2, 5
Single-ended DC low-point level output voltage
9OL'&
[9DDQ
9
1, 2, 5
Single-ended DC high-point level output voltage
92+$&
977[9DDQ
9
1, 2, 3, 6
Single-ended DC low-point level output voltage
9OL$&
977[9DDQ
9
1, 2, 3, 6
Delta RON between pull-up and pull-down for DQ/DQS
MM383'
Test load for AC timing and output slew rates
-10
10
3
2XWSXWWR9TT9DD4YLD:UHVLVWRU
127(6
1.
5=4RI:”ZLWK5=4HQDEOHGGHIDXOW:GULYHUDQGLVDSSOL-
5.
6HH7DEOHRQSDJH,9FXUYHOLQHDULW\'RQRWXVH$&7HVWORDG
FDEOH DIWHU SURSHU =4 FDOLEUDWLRQ KDV EHHQ SHUIRUPHG DW D VWDEOH WHP-
6.
6HH7DEOHRQSDJHIRURXWSXWVOHZUDWH
SHUDWXUHDQGYROWDJH9DD4 9DD9VV4 9VV
6HH7DEOHRQSDJHIRUDGGLWLRQDOLQIRUPDWLRQ
2.
9TT 9DD4
8.
6HH )LJXUH RQ SDJH IRU DQ H[DPSOH RI D VLQJOHHQGHG RXWSXW
3.
6HH)LJXUHRQSDJHIRUWKHWHVWORDGFRQILJXUDWLRQ
7KH9QVPD[LPXPLVDSSOLFDEOHIRUDVLQJOH'4VLJQDOZKHQLWLVVZLWFK-
VLJQDO
LQJIURPHLWKHU+,*+WR/2:RU/2:WR+,*+ZKLOHWKHUHPDLQLQJ'4
VLJQDOVLQWKHVDPHE\WHODQHDUHFRPELQDWLRQVWKHPD[LPXPOLPLWRI9
QVPD[LPXPLVUHGXFHGWR9QV
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 43: DIFFERENTIAL OUTPUT DRIVER CHARACTERISTICS PACKAGE OUTLINE DIMENSIONS
Parameter/Condition
Output leakage current:'4DUHGLVDEOHG
Symbol
MIN
MAX
UNITS
NOTES
I2=
-5
5
X$
1
SRQDIFF
5
12
9QV
1
92;$&
95()-150
95()
P9
1, 2, 3
9d9287d9DD42'7LV+,*+
Output slew rate:'LIIHUHQWLDOIRUULVLQJDQGIDOOLQJHGJHV
PHDVXUHEHWZHHQ9OL',))$& [9DD4DQG92+
$& [9DDQ
Output differential cross-point voltage
Differential high-level output voltage
92+',))$&
[9DDQ
9
Differential low-level output voltage
9OL',))$&
[9DDQ
9
1, 5
Delta RON between pull-up and pull-down for DQ/DQS
MM383'
-10
10
2XWSXWWR9TT9DD4YLD:UHVLVWRU
Test load for AC timing and output slew rates
3
127(6
1.
5=4RI:”ZLWK5=4HQDEOHGGHIDXOW:GULYHUDQGLVDSSOL-
6HH7DEOHRQSDJHIRUWKHRXWSXWVOHZUDWH
FDEOH DIWHU SURSHU =4 FDOLEUDWLRQ KDV EHHQ SHUIRUPHG DW D VWDEOH WHP-
5.
6HH7DEOHRQSDJHIRUDGGLWLRQDOLQIRUPDWLRQ
SHUDWXUHDQGYROWDJH9DD4 9DD9VV4 9VV
6.
6HH)LJXUHRQSDJHIRUDQH[DPSOHRIDGLIIHUHQWLDORXWSXWVLJQDO
2.
95() 9DD4
3.
6HH)LJXUHRQSDJHIRUWKHWHVWORDGFRQILJXUDWLRQ
FIGURE 20 - DQ OUTPUT SIGNAL
MAX output
VOH(AC)
VOL(AC)
MIN output
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OUTPUT CHARACTERISTICS AND OPERATING CONDITIONS
FIGURE 21 - DIFFERENTIAL OUTPUT SIGNAL
MAX output
VOH(DIFF)
X
VOX(AC) MAX
X
X
VOX(AC) MIN
X
VOL(DIFF)
MIN output
REFERENCE OUTPUT LOAD
)LJXUHUHSUHVHQWVWKHHIIHFWLYHUHIHUHQFHORDGRI:XVHGLQGHILQLQJWKHUHOHYDQWGHYLFH$&WLPLQJSDUDPHWHUVH[FHSW2'7UHIHUHQFHWLPLQJDVZHOODVWKH
RXWSXWVOHZUDWHPHDVXUHPHQWV,WLVQRWLQWHQGHGWREHDSUHFLVHUHSUHVHQWDWLRQRIDSDUWLFXODUV\VWHPHQYLURQPHQWRUDGHSLFWLRQRIWKHDFWXDOORDGSUHVHQWHG
E\DQ\VSHFLILF,QGXVWU\WHVWV\VWHPDSSDUDWXV6\VWHPGHVLJQHUVVKRXOGXVH,%,6RURWKHUVLPXODWLRQWRROVWRFRUUHODWHWKHWLPLQJUHIHUHQFHORDGSUHVHQWHGRU
H[KLELWHGRQWKHV\VWHPRUV\VWHPHQYLURQPHQW
FIGURE 22 - REFERENCE OUTPUT LOAD FOR AC TIMING AND OUTPUT SLEW RATE
DUT
VREF
DQ
DQS
DQS#
VDDQ/2
RTT = 25Ω
VTT = VDDQ/2
Timing Reference Point
ZQ
RZQ = 240Ω
VSS
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SLEW RATE DEFINITIONS FOR SINGLE-ENDED OUTPUT SIGNALS
7KHVLQJOHHQGHGRXWSXWGULYHULVVXPPDUL]HGLQ7DEOH:LWKWKHUHIHUHQFHORDGIRUWLPLQJPHDVXUHPHQWVWKHRXWSXWVOHZUDWHIRUIDOOLQJDQGULVLQJHGJHV
LVGHILQHGDQGPHDVXUHGEHWZHHQ9OL$&DQG92+$&IRUVLQJOHHQGHGVLJQDOVDVLQGLFDWHGLQ7DEOHDQG)LJXUH
TABLE 44: SINGLE-ENDED OUTPUT SLEW RATE
Measured
Output Slew Rate (Linear Signals)
Output
PACKAGE OUTLINE DIMENSIONS
Edge
From
To
5LVLQJ
9OL$&
92+$&
Falling
92+$&
9OL$&
Calculation
92+$&9OL $&
'756(
DQ
92+$&9OL$&
'7)6(
FIGURE 23 - NOMINAL SLEW RATE DEFINITION FOR SINGLE-ENDED OUTPUT SIGNALS
ΔTRSE
VOH(AC)
VTT
VOL(AC)
ΔTFSE
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SLEW RATE DEFINITIONS FOR DIFFERENTIAL OUTPUT SIGNALS
7KHGLIIHUHQWLDORXWSXWGULYHULVVXPPDUL]HGLQ7DEOH:LWKWKHUHIHUHQFHORDGIRUWLPLQJPHDVXUHPHQWVWKHRXWSXWVOHZUDWHIRUIDOOLQJDQGULVLQJHGJHVLV
GHILQHGDQGPHDVXUHGEHWZHHQ9OL$&DQG92+$&IRUGLIIHUHQWLDOVLJQDOVDVVKRZQLQ7DEOHDQG)LJXUH
TABLE 45: DIFFERENTIAL OUTPUT SLEW RATE DEFINITION
Measured
Output Slew Rate (Linear Signals)
Output
PACKAGE OUTLINE DIMENSIONS
Edge
From
To
5LVLQJ
9OL',))$&
92+',))$&
Falling
92+',))$&
9OL',))$&
Calculation
92+',))$&9OL ',))$&
'TRDIFF
DQS, DQS\
92+',))$&9OL',))$&
'TFDIFF
FIGURE 24 - NOMINAL DIFFERENTIAL OUTPUT SLEW RATE DEFINITION FOR DQS, DQS#
VOH(DIFF) AC
0
VOL(DIFF) AC
ΔTFDIFF
LOGIC Devices Incorporated
www.logicdevices.com
50
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 46: SPEED BINS
PACKAGE OUTLINE DIMENSIONS
''5''5''5
>&:/ @>&:/ @>&:/ @
Parameter
Symbol
MIN
MAX
MIN
MAX
MIN
t5&'
15
-
-
13.91
-
QV
35(&+$5*(FRPPDQGSHULRG
t53
15
-
-
13.91
-
QV
$&7,9$7(WR$&7,9$7(RU5()5(6+FRPPDQGSHULRG
t5&
51
-
-
-
QV
t5$6
36
9 x t5(),
35
9 x t5(),
9 x t5(),
QV
1
&:/ t&.$9*
3
3.3
3
3.3
3
3
QV
2
&:/ t&.$9*
QV
3
QV
3
QV
2
$&7,9$7(WRLQWHUQDO5($'RU:5,7(GHOD\WLPH
$&7,9$7(WR35(&+$5*(FRPPDQGSHULRG
&/ &/ &/ &/ MAX UNITS NOTES
&:/ t&.$9*
&:/ t&.$9*
&:/ t&.$9*
QV
3
&:/ t&.$9*
QV
3
&:/ t&.$9*
&:/ t&.$9*
&:/ 2.5
3.3
2.5
3.3
2.5
3.3
QV
3
QV
2,3
t&.$9*
QV
3
&:/ t&.$9*
QV
3
&:/ t&.$9*
&:/ t&.$9*
1.5
5, 6, 8, 10
6XSSRUWHG&/6HWWLQJV
1.5
5, 6, 8,10
QV
3
QV
2,3
5, 6, 8, 10, 11,13
&.
1.5
6XSSRUWHG&:/6HWWLQJV
&.
127(6
1.
t5(),GHSHQGVRQt23(5
2.
7KH &/ DQG &:/ VHWWLQJ UHVXOW LQ t&. UHTXLUHPHQWV :KHQ PDNLQJ D
VHOHFWLRQRI t&.ERWK&/DQG&:/UHTXLUHPHQWVHWWLQJVQHHGWREHIXO-
3.
5HVHUYHGILOOHGEORFNVVHWWLQJVDUHQRWDOORZHG
ILOOHG
LOGIC Devices Incorporated
www.logicdevices.com
51
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
t
t
CK (AVG)
CKDLL_DIS
52
Cumulave error across
3 Cycles
4 Cycles
5 Cycles
6 Cycles
7 Cycles
8 Cycles
9 Cycles
10 Cycles
11 Cycles
12 Cycles
2 Cycles
n = 13, 14 … 49, 50 Cycles
DLL LOCKED
DLL LOCKING
ERR3PERR
t
ERRnPER
ERR4PERR
t
ERR5PERR
t
ERR6PERR
t
ERR7PERR
t
ERR8PERR
t
ERR9PERR
t
ERR10PERR
t
ERR11PERR
t
ERR12PERR
t
t
t
JITCC
JITCC, LCK
t
ERR2PERR
t
-140
-155
-168
-177
-186
-193
-200
-205
-210
-215
-118
0.43
t
Clock absolute LOW pulse width
Cycle-to-Cycle JITTER
0.43
CH (ABS)
CL (ABS)
0.53
0.53
80
70
0.47
0.47
-70
-60
0.53
0.53
70
60
0.47
0.47
-60
-50
See SPEED BIN TABLE (#49) for tCK range allowed
0.53
0.53
60
50
118
-103
0.43
0.43
140
120
103
-
-
-88
0.43
0.43
120
100
140
-122
122
-105
155
-136
136
-117
168
-147
147
-126
177
-155
155
-133
186
-163
163
-139
193
-169
169
-145
200
-175
175
-150
205
-180
180
-154
210
-184
184
-158
215
-188
188
-161
tERRnPER MIN = (1+0.68ln[n]) x tJITPER MIN
tERRnPER MAX = (1+0.68ln[n]) x tJITPER MAX
160
140
-
-
105
117
126
133
139
145
150
154
158
161
88
-
-
MIN=tCK (AVG) MIN+tJITPER MIN; MAX=tCK (AVG)MAX+tJITPER MAX
0.47
0.47
-80
-70
Clock absolute HIGH pusle width
CH (AVG)
t
CL (AVG)
t
JITPER
t
JITPER, LCK
t
CLK (ABS)
t
Symbol
t
Parameter
TC = 0˚C to <85˚C
Clock period average: DLL
TC = 85˚C to 105˚C
disable mode
TC = >105˚C to ≤125˚C
Clock period average: DLL enable mode
HIGH pulse width average
LOW pulse width average
DLL LOCKED
Clock period JITTER
DLL LOCKING
Clock absolute period
-15 (DDR3-1333)
-12 (DDR3-1600)
-11 (DDR3-1866)
[CWL=1.5; 10-10-10] [CWL=1.25; 11-11-11] [CWL=1.07; 13-13-13]
MIN
MAX
MIN
MAX
MIN
MAX
8
7800
8
7800
8
7800
8
3900
8
3900
8
3900
8
2900
8
2900
-
ps
ps
ps
ps
ps
ps
ps
ps
ps
ps
ps
17
17
17
17
17
17
17
17
17
17
17
16
16
17
15
tCK (AVG)
ps
ps
ps
14
10,11
12
12
13
13
Notes
9,42
9,42
9,42
tCK (AVG)
ns
CK
CK
ps
ps
ps
ns
Units
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 47 (SHEET 1 OF 6) - ELECTRICAL CHARACTERISTICS AND AC OPERATING CONDITIONS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
53
DQS, DQS\ DIFFERENTIAL READ postamble
DQS, DQS\ DIFFERENTIAL Output HIGH me
DQS, DQS\ DIFFERENTIAL Output LOW me
DQS, DQS\ LOW-Z me (RL-1)
DQS, DQS\ HIGH-Z me (RL+BL/2)
DQS, DQS\ DIFFERENTIAL READ preamble
DQS, DQS\ RISING to/from RISING CK, CK\ when DLL is disabled
DQS, DQS\ RISING to/from RISING CK, CK\
DQS,DQS\ RISING to CK, CK\ RISING
DQS, DQS\ DIFFERENTIAL Input Low pulse width
DQS, DQS\ DIFFERENTIAL Input HIGH pulse width
DQS, DQS\ FALLING Setup to CK, CK\ RISING
DQS, DQS\ FALLING Hold from CK, CK\ RISING
DQS, DQS\ DIFFERENTIAL WRITE preamble
DQS, DQS\ DIFFERENTIAL WRITE postamble
t
QH
0.38
t
RPST
DQSK
DLL_DIS
t
QSH
t
QSL
t
LZ (DQS)
t
HZ (DQS)
t
RPRE
t
0.3
0.4
0.4
-500
0.9
1
-500
LZ (DQ)
HZ (DQ)
DQ Strobe Input Timing
t
-0.25
DQSS
t
0.45
DQSL
t
0.45
DQSH
t
0.2
DSS
t
0.2
DSH
t
0.9
WPRE
t
0.3
WPST
DQ Strobe Output Timing
t
-255
DQSCK
t
DQ LOW-Z me from CK, CK\
DQ HIGH-A me from CK, CK\
Base (specificaon)
VREF @ 1V/ns
Base (specificaon)
VREF @ 1V/ns
Base (specificaon)
VREF @ 1V/ns
t
DQ Output HOLD me from DQS, DQS\
DQS, DQS\ to DQ SKEW, per access
Data HOLD me from DQS,
DQS\
Minimum Data Pulse Width
Data SETUP me to DQS, DQS\
Data SETUP me to DQS, DQS\
Parameter
Note 27
250
250
Note 24
10
255
0.25
0.55
0.55
-
250
250
-
0.3
0.4
0.4
-450
0.9
1
-225
-0.27
0.45
0.45
0.18
0.18
0.9
0.3
-
-450
0.38
Note 27
225
225
Note 24
10
225
0.27
0.55
0.55
-
225
225
-
0.3
0.4
0.4
-390
0.9
1
-195
-0.27
0.45
0.45
0.18
0.18
0.9
0.3
-
-390
0.38
Note 27
195
195
Note 24
10
195
0.27
0.55
0.55
-
195
195
-
-15 (DDR3-1333)
-12 (DDR3-1600)
-11 (DDR3-1866)
[CWL=1.5; 10-10-10] [CWL=1.25; 11-11-11] [CWL=1.07; 13-13-13]
Symbol
MIN
MAX
MIN
MAX
MIN
MAX
DQ Input Timing
t
DS AC175
10
30
t
DS AC150
180
135
160
65
45
20
t
DH AC100
165
145
120
t
400
360
320
DIPW
DQ Ouput Timing
t
125
100
85
DQSQ
CK
CK
CK
ps
ps
CK
ns
ps
CK
CK
CK
CK
CK
CK
CK
ps
ps
tCK (AVG)
ps
ps
ps
ps
ps
ps
ps
ps
Units
23,27
21
21
22,23
22,23
23,24
26
23
25
25
25
22,23
22,23
21
18,19
19,20
18,19
19,20
18,19
19,20
41
Notes
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 47 (SHEET 2 OF 6) - ELECTRICAL CHARACTERISTICS AND AC OPERATING CONDITIONS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
2KB page size
1KB page size
MULTIPURPOSE REGISTER READ burst end to mode register set for
mulpurpose register exit
MODE REGISTER SET command cycle me
MODE REGISTER SET command update delay
t
DAL
MPRR
MOD
MRD
t
t
t
RTP
CCD
MIN = 1CK; MAX = n/a
MIN = 4CK; MAX = n/a
MIN = greater of 12CK or 15ns; MAX = n/a
MIN = WR + tRP/tCK (AVG); MAX = n/a
MIN = greater of 4CK or 7.5ns; MAX = n/a
MIN = 4CK; MAX = n/a
t
MIN = greater of 4CK or 7.5ns; MAX = n/a
MIN = 15ns; MAX = n/a
WTR
WR
t
t
t
Auto precharge WRITE recovery + PRECHARGE me
Delay from start of internal WRITE transacon to internal READ
command
READ-to-PRECHARE me
CAS\-to-CAS\ command delay
WRITE recovery me
Four ACTIVATE windows for 1KB page size
Four ACTIVATE windows for 2KB page size
ACTIVATE-to-ACTIVATE
minimum command period
DLL Locking me
Base (specificaon)
CTRL, CMD, ADDR setup to CK,
VREF @ 1V/ns
CK\
Base (specificaon)
CTRL, CMD, ADDR setup to CK,
VREF @ 1V/ns
CK\
Base (specificaon)
CTRL, CMD, ADDR hold to CK,
VREF @ 1V/ns
CK\
Minimum CTRL, CMD, ADDR pulse width
ACTIVATE to Internal READ or WRITE delay
PRECHARGE command period
ACTIVATE-to-PRECHARGE command period
ACTIVATE-to-ACTIVATE command period
Parameter
-15 (DDR3-1333)
-12 (DDR3-1600)
-11 (DDR3-1866)
[CWL=1.5; 10-10-10] [CWL=1.25; 11-11-11] [CWL=1.07; 13-13-13]
Symbol
MIN
MAX
MIN
MAX
MIN
MAX
Command and Address Timing
t
512
512
512
DLLK
65
65
45
t
IS AC175
240
220
200
150
190
170
t
IS AC150
275
340
320
100
140
120
t
IH DC100
200
240
220
t
535
620
560
IPW
t
See "Speed Bin Table (#49) for tRCD
RCD
t
See "Speed Bin Table (#49) for tRP
RP
t
See "Speed Bin Table (#49) for tRAS
RAS
t
See "Speed Bin Table (#49) for tRC
RCD
MIN=greater of 4CK MIN=greater of 4CK MIN=greater of 4CK
or 5ns
or 6ns
or 6ns
t
RRD
MIN=greater of 4CK
MIN=greater of 4CK or 7.5ns
or 6ns
25
30
30
t
FAW
35
45
40
-
CK
CK
CK
CK
CK
CK
CK
CK
31,34
31,32,33
31
31
31
CK
ns
ns
31
28
29,30
20,30
29,30
20,30
29,30
20,30
41
31
31
31,32
31
Notes
CK
CK
ps
ps
ps
ps
ps
ps
ps
ns
ns
ns
ns
Units
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 47 (SHEET 3 OF 6) - ELECTRICAL CHARACTERISTICS AND AC OPERATING CONDITIONS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
55
TC ≤ 85˚C
TC >85˚C ≤ 105˚C
TC >105˚C ≤ 125˚C
TC ≤ 85˚C
TC >85˚C ≤ 105˚C
TC >105˚C ≤ 125˚C
Valid clocks before SELF REFRESH exit, POWER-DOWN exit, or RESET
exit
Valid clocks aer SELF REFRESH entry or POWER-DOWN entry
MINIMUM CKE LOW pulse width for SELF REFRESH entry to SELF
REFRESH exit ming
EXIT SELF REFRESH TO commands requiring a locked DLL
Exit SELF REFRESH TO commands not requiring a locked DLL
Maximum REFRESH
period/interval
Maximum REFRESH period
REFRESH-to-ACTIVATE or REFRESH command period
RESET\ LOW to power supplies stable
RESET\ LOW to I/O and RTT HIGH-Z
Begin power supply ramp to power supplies stable
Exit RESET from CKE HIGH to a valid command
Normal operaon
POWER-UP and RESET operaon
ZQCS command: Short Calibraon Time
ZQCL command: Long
Calibraon me
Parameter
ZQINIT
512
512
512
t
VDDPR
REFI
-
CKSRE
CKESR
XSDLL
XS
CKSRX
t
t
t
t
t
SELF REFRESH Timing
t
t
RPS
IOZ
REFRESH Timing
t
RFC - 1Gb
t
RFC - 2Gb
t
RFC - 4Gb
t
MIN = greater of 5CK or 10ns; MAX = n/a
MIN = greater of 5CK or 10ns; MAX = n/a
MIN = tCKE (MIN) + CK; MAX = n/a
MIN = tDLLK (MIN); MAX = n/a
CK
CK
CK
CK
CK
28
36
36
36
36
36
36
ns
ns
ns
ms
ms
ms
μs
μs
μs
MIN = 110; MAX = 70,200
MIN = 160; MAX = 70,200
MIN = 260; MAX = 70,200
64 (1X)
32 (2X)
24
7.8
3.9
2.9
MIN = greater of 5CK or tRFC + 10ns; MAX = n/a
35
ms
CK
CK
CK
CK
Notes
ms
ns
-
-
Units
MIN = 0; MAX = 200
MIN = n/a; MAX = 20
MIN = n/a; MAX = 200
256
256
256
ZQOPER
t
64
64
64
ZQCS
Inializaon and RESET Timing
t
MIN = greater of 5CK or tRFC + 10ns; MAX = n/a
XPR
t
t
-15 (DDR3-1333)
-12 (DDR3-1600)
-11 (DDR3-1866)
[CWL=1.5; 10-10-10] [CWL=1.25; 11-11-11] [CWL=1.07; 13-13-13]
Symbol
MIN
MAX
MIN
MAX
MIN
MAX
Calibraon Timing
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 47 (SHEET 4 OF 6) - ELECTRICAL CHARACTERISTICS AND AC OPERATING CONDITIONS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
56
t
BL8 (OTF, MRS) BC4OTF
BC4MRS
WRPDEN
WRPDEN
RDPDEN
WRAPDEN
t
t
t
XP
XPDLL
t
t
WRAPDEN
POWER-DOWN Exit Timing
t
BC4MRS
BL8 (OTF, MRS) BC4OTF
DLL on, any valid command, or DLL off to commands not requiring DLL
locked
PRECHARGE POWER-DOWN with DLL off to command requiring DLL
locked
WRITE with AUTO PRECHARGE
command to POWER-DOWN
entry
WRITE Command to POWERDOWN entry
READ/READ with AUTO PRECHARGE commant to POWER-DOWN entry
PRPDEN
REFPDEN
MRSPDEN
REFRESH command to POWER-DOWN entry
MRS command to POWER-DOWN entry
t
t
ACTPDEN
PRECHARGE/PRECHARGE ALL command to POWER-DOWN entry
t
WL - 1CK
ANPD + tXPDLL
MIN = 2
MIN = 2
MIN = 2
MIN = Greater of 10CK or 24ns; MAX = n/a
MIN = Greater of 3CK or 6.0ns; MAX = n/a
MIN = WL + 2 + WR + 1
MIN = WL + 4 + WR + 1
t
MIN = WL + 2 + WR/ CK (AVG)
t
MIN = WL + 4 + tWR/tCK (AVG)
MIN = RL + 4 + 1
MIN = tMOD (MIN)
MIN = 1
MIN = 1
MIN = 1
t
Greater of tANPD or tRFC - REFRESH command to CKE LOW me
POWER-DOWN Entry MINIMUM Timing
t
ACTIVATE command to POWER-DOWN entry
PDX
POWER-DOWN exit period: ODT either synchronous or asynchronous
ANPD
PDE
t
POWER-DOWN entry period: ODT eher synchronous or asynchronous
Begin POWER-DOWN period prior to CKE registered HIGH
Command pass disable delay
POWER-DOWN entry to POWER-DOWN exit ming
CKE MIN pulse width
Parameter
-15 (DDR3-1333)
-12 (DDR3-1600)
-11 (DDR3-1866)
[CWL=1.5; 10-10-10] [CWL=1.25; 11-11-11] [CWL=1.07; 13-13-13]
Symbol
MIN
MAX
MIN
MAX
MIN
MAX
POWER-DOWN Timing
Greater of 3CK or
Greater of 3CK or
Greater of 3CK or
t
CKE (MIN)
5.625ns
5ns
5ns
t
MIN = 1; MAX = n/a
CPDED
t
MIN = tCKE (MIN); MAX = 60ms
PD
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
CK
Units
28
37
Notes
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 47 (SHEET 5 OF 6) - ELECTRICAL CHARACTERISTICS AND AC OPERATING CONDITIONS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
First DQS, DQS\ RISING edge
DQS; DQS\ delay
WRITE Leveling SETUP from rising CK, CK\ crossing to rising DQS, DQS\
crossing
WRITE Leveling HOLD from rising DQS, DQS\ crossing to rising CK, CK\
crossing
WRITE Leveling output delay
WRITE Leveling output error
RTT_NOM-to=RTT_WR change skew
RTT_WR-to-RTT_NOM change skew - BC4
RTT_WR-to-RTT_NOM change skew - BC8
RTT dynamic change skew
t
WLH
WLS
WLO
WLOE
t
t
t
0
0
195
195
9
2
-
-
-
0
0
163
163
40
25
7.5
2
-
-
-
WL - 2CK
4CK + ODTL OFF
6CK + ODTL OFF
0.3
0.7
MIN = 4; MAX = n/a
ODTH4
Dynamic ODT Timing
ODTLCNW
ODTLCNW4
ODTLCNW8
t
0.3
ADC
WRITE Leveling Timing
t
40
WLMRD
t
25
WLDQSEN
MIN = 6; MAX = n/a
ODTH8
0.7
t
Asynchronous RTT TURN-OFF delay (POWER-DOWN with DLL OFF)
ODT HIGH me without WRITE command or with WRITE command and
BC8
ODT HIGH me without WRITE command or with WRITE command and
BC4
MIN = 2; MAX = 8.5
AONPD
AOFPD
MIN = 2; MAX = 8.5
t
Asynchronous RTT TURN-ON delay (POWER-DOWN with DLL OFF)
RTT synchronous TURN-ON delay
RTT synchronous TURN-OFF delay
RTT TURN-ON from ODTL ON reference
RTT TURN-OFF from ODTL OFF reference
Parameter
0
0
140
140
40
25
0.3
7.5
2
-
-
-
0.7
-12 (DDR3-1600)
-15 (DDR3-1333)
-11 (DDR3-1866)
[CWL=1.5; 10-10-10] [CWL=1.25; 11-11-11] [CWL=1.07; 13-13-13]
Symbol
MIN
MAX
MIN
MAX
MIN
MAX
ODT Timing
ODTL on
ODTL off
t
-250
250
-225
225
-195
195
AON
t
0.3
0.7
0.3
0.7
0.3
0.7
AOF
ns
ns
ps
ps
CK
CK
CK
CK
CK
CK
CK
CK
ns
ns
CK
CK
ps
CK
Units
39
40
38
38
40
23,38
39,40
Notes
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 47 (SHEET 6 OF 6) - ELECTRICAL CHARACTERISTICS AND AC OPERATING CONDITIONS
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
NOTES
1.
3DUDPHWHUVDUHDSSOLFDEOHZLWK“&d T$ d“&DQG9DD9DD4 9”9
2.
$OOYROWDJHVDUHUHIHUHQFHGWR9VV
3.
2XWSXWWLPLQJVDUHRQO\YDOLGIRU5ONRXWSXWEXIIHUVHOHFWLRQ
8QLW t&. $9* UHSUHVHQWV WKH DFWXDO t&. $9* RI WKH LQSXW FORFN
XQGHURSHUDWLRQ8QLW&.UHSUHVHQWVRQHFORFNF\FOHRIWKHLQSXWFORFN
FRXQWLQJWKHDFWXDOFORFNHGJHV
5.
6.
GHYLDWHIURPRQHF\FOHWRWKHQH[W,WLVLPSRUWDQWWRNHHSF\FOHWRF\FOH
MLWWHUDWDPLQLPXPGXULQJWKH'//ORFNLQJWLPH 7KH FXPXODWLYH MLWWHU HUURU t(55Q3(5 ZKHUH Q LV WKH QXPEHU RI
FORFNVEHWZHHQDQGLVWKHDPRXQWRIFORFNWLPHDOORZHGWRDFFXPXODWH FRQVHFXWLYHO\ DZD\ IURP WKH DYHUDJH FORFN RYHU Q QXPEHU RI
FORFNF\FOHV
18.
t'6EDVHDQGt'+EDVHYDOXHVDUHIRUDVLQJOHHQGHG9QV'4VOHZ
UDWHDQG9QVIRUGLIIHUHQWLDO'46'46?VOHZUDWH
19.
7KHVHSDUDPHWHUVDUHPHDVXUHGIURPDGDWDVLJQDO'0'4'4h
'4QDQGVRIRUWKWUDQVLWLRQHGJHWRLWVUHVSHFWLYHGDWDVWUREHVLJQDO
'46'46?FURVVLQJ
20.
$OO WLPLQJV WKDW XVH WLPHEDVHG YDOXHV QV ˜V PV VKRXOG XVH t&.
$9* WR GHWHUPLQH WKH FRUUHFW QXPEHU RI FORFNV 7DEOH XVHV &.
RU&.$9*LQWHUFKDQJHDEO\,QWKHDPELHQWRIQRQLQWHUJHUUHVXOWV
DOOPLQLPXPOLPLWVDUHWREHURXQGHGXSWRWKHQHDUHVWZKROHLQWHJHU
7KHVHWXSDQGKROGWLPHVDUHOLVWHGFRQYHUWLQJWKHEDVHVSHFLILFDWLRQ
YDOXHVWRZKLFKGHUDWLQJWDEOHVDSSO\WR95()ZKHQWKHVOHZUDWHLV
9QV7KHVHYDOXHVZLWKDVOHZUDWHRI9QVDUHIRUUHIHUHQFHRQO\
21.
7KHXVHRI6752%(RU'46',))UHIHUVWRWKH'46DQG'46?GLIIHUHQWLDOFURVVLQJSRLQWZKHQ'46LVWKHULVLQJHGJH7KHXVHRI&/2&.RU
&.UHIHUVWRWKH&.DQG&.?GLIIHUHQWLDOFURVVLQJSRLQWZKHQ&.LVWKH
ULVLQJHGJH
:KHQ WKH GHYLFH LV RSHUDWHG ZLWK LQSXW FORFN MLWWHU WKLV SDUDPHWHU
QHHGVWREHGHUDWHGE\WKHDFWXDOt-,73(5ODUJHURIt-,73(50,1RU
t-,73(50$;RIWKHLQSXWFORFNRXWSXWGHUDWLQJVDUHUHODWLYHWRWKH
6'5$0LQSXWFORFN
22.
6LQJOHHQGHGVLJQDOSDUDPHWHU
23.
7KH6'5$0RXWSXWWLPLQJLVDOLJQHGWRWKHQRPLQDORUDYHUDJHFORFN
0RVWRXWSXWSDUDPHWHUVPXVWEHGHUDWHGE\WKHDFWXDOMLWWHUHUURUZKHQ
LQSXWFORFNMLWWHULVSUHVHQWHYHQZKHQZLWKLQVSHFLILFDWLRQ7KLVUHVXOWV
LQ HDFK SDUDPHWHU EHFRPLQJ ODUJHU 7KH IROORZLQJ SDUDPHWHUV DUH
UHTXLUHG WR EH GHUDWHG E\ VXEWUDFWLQJ t(553(5 0$; t'46&.
0,1t/='460$;t/='40$;DQGt$210$;7KHSDUDPHter t535(0,1LVGHUDWHGE\VXEWUDFWLQJt-,73(50$;ZKLOHt535(
0$;LVGHUDWHGE\t-,73(50,1
$&WLPLQJDQG,DDWHVWVPD\XVHD9ILWR9,+VZLQJRIXSWRP9,
WKHWHVWHQYLURQPHQWEXWLQSXWWLPLQJLVVWLOOUHIHUHQFHGWR95()H[FHSW
tIS, t,+tDS, and t'+XVHWKH$&'&WULSSRLQWVDQG&.&.?DQG'46
'46?XVHWKHLUFURVVLQJSRLQWV7KHPLQLPXPVOHZUDWHIRUWKHLQSXW
VLJQDOVXVHGWRWHVWWKHGHYLFHLV9QVIRUVLQJOHHQGHGLQSXWVDQG9
QVIRUGLIIHUHQWLDOLQSXWVLQWKHUDQJHEHWZHHQ9IL$&DQG9,+$&
8.
7KLVRXWSXWORDGLVXVHGIRUDOO$&WLPLQJH[FHSW2'7UHIHUHQFHWLPLQJ
DQGVOHZUDWHV7KHDFWXDO WHVW ORDG PD\ EH GLIIHUHQW 7KH RXWSXW
VLJQDOYROWDJHUHIHUHQFHSRLQWLV9DD4IRUVLQJOHHQGHGVLJQDOVDQG
WKHFURVVLQJSRLQWIRUGLIIHUHQWLDOVLJQDOV
9.
:KHQRSHUDWLQJLQ'//GLVDEOHPRGH/2*,&'HYLFHV,QF/',GRHV
QRWZDUUDQWFRPSOLDQFHZLWKQRUPDOPRGHWLPLQJVRUIXQFWLRQDOLW\
7KHPD[LPXPSUHDPEOHLVERXQGE\t/='460$;
10.
7KHFORFNuVt&.$9*LVWKHDYHUDJHFORFNRYHUDQ\FRQVHFXWLYH
FORFNVDQG t&.$9*0,1LVWKHVPDOOHVWFORFNUDWHDOORZHGZLWKWKH
H[FHSWLRQRIDGHYLDWLRQGXHWRFORFNMLWWHU,QSXWFORFNMLWWHULV DOORZHG
SURYLGHGLWGRHVQRWH[FHHGYDOXHVVSHFLILHGDQGPXVWEHRIDUDQGRP
*DXVVLDQGLVWULEXWLRQLQQDWXUH
25.
7KHVHSDUDPHWHUVDUHPHDVXUHGIURPDGDWDVWUREHVLJQDO'46'46?
FURVVLQJWRLWVUHVSHFWLYHFORFNVLJQDO&.&.?FURVVLQJ7KHVSHFLILFDWLRQ YDOXHV DUH QRW DIIHFWHG E\ WKH DPRXQW RI FORFN MLWWHU DSSOLHG
DVWKHVHDUHUHODWLYHWRWKHFORFNVLJQDOFURVVLQJ7KHVHSDUDPHWHUV
VKRXOGEHPHWZKHWKHUFORFNMLWWHULVSUHVHQWRUQRW
11.
6SUHDGVSHFWUXPLVQRWLQFOXGHGLQWKHMLWWHUVSHFLILFDWLRQYDOXHV+RZHYHU WKH LQSXW FORFN FDQ DFFRPPRGDWH VSUHDGVSHFWUXP DW D VZHHS
UDWHLQWKHUDQJHRIN+]ZLWKDQGDGGLWLRQDORIt&.$9*DVD
ORQJWHUPMLWWHUFRPSRQHQWKRZHYHUWKHVSUHDGVSHFWUXPPD\QRWXVH
DFORFNUDWHEHORZt&.$9*0,1 26.
The t'46&.'//B',6SDUDPHWHUEHJLQV&/$/F\FOHVDIWHUWKH
5($'FRPPDQG
12.
7KHPD[LPXPSRVWDPEOHLVERXQGE\t+='460$;
7KHFORFNuVt&+$9*DQGt&/$9*DUHWKHDYHUDJHKDOIFORFNSHULRG
RYHUDQ\FRQVHFXWLYHFORFNVDQGLVWKHVPDOOHVWFORFNKDOISHULRG
DOORZHGZLWKWKHH[FHSWLRQRIYDOXHVVSHFLILHGDQGPXVWRIDUDQGRP
*DXVVLDQGLVWULEXWLRQLQQDWXUH
13.
7KHSHULRGMLWWHUt-,73(5LVWKHPD[LPXPGHYLDWLRQLQWKHFORFNSHULRG
IURPWKHDYHUDJHRUQRPLQDOFORFN,WLVDOORZHGLQHLWKHUWKHSRVLWLYHRU
QHJDWLYHGLUHFWLRQ
t&+$%6LVWKHDEVROXWHLQVWDQWDQHRXVFORFNKLJKSXOVHZLGWKDVPHDVXUHGIURPRQHULVLQJHGJHWRWKHIROORZLQJIDOOLQJHGJH 15.
t&/$%6LVWKHDEVROXWHLQVWDQWDQHRXVFORFNORZSXOVHZLGWKDVPHDVXUHGIURPRQHIDOOLQJHGJHWRWKHIROORZLQJULVLQJHGJH
16.
7KH F\FOHWRF\FOH MLWWHU t-,7&& LV WKH DPRXQW WKH FORFN SHULRG FDQ
LOGIC Devices Incorporated
www.logicdevices.com
58
28.
&RPPDQGVUHTXLULQJDORFNHG'//DUH5($'DQG5'$3DQGV\QFKURQRXV 2'7 FRPPDQGV ,Q DGGLWLRQ DIWHU DQ\ FKDQJH RI ODWHQF\
t;3'//WLPLQJPXVWEHPHW
29.
t,6EDVHDQG t,+EDVHYDOXHVDUHIRUDVLQJOHHQGHG9QVFRQWURO
FRPPDQGDGGUHVVVOHZUDWHDQG9QV&.&.GLIIHUHQWLDOVOHZUDWH
30.
7KHVHSDUDPHWHUVDUHPHDVXUHGIURPDFRPPDQGDGGUHVVVLJQDOWUDQVLWLRQHGJHWRLWVUHVSHFWLYHFORFN&.&.?VLJQDOFURVVLQJ7KHVSHFLILFDWLRQ YDOXHV DUH QRW DIIHFWHG E\ WKH DPRXQW RI FORFN MLWWHU DSSOLHG
DV WKH VHWXS DQG KROG WLPHV DUH UHODWLYH WR WKH FORFN VLJQDO FURVVLQJ
WKDWODWFKHVWKHFRPPDQGDGGUHVV7KHVHSDUDPHWHUVVKRXOGEHPHW
ZKHWKHUFORFNMLWWHULVSUHVHQWRUQRW
31.
)RU WKHVH SDUDPHWHUV WKH ''5 6'5$0 GHYLFH VXSSRUWV WQ3$5$0
Q&. 58 t3$5$0 >[email protected] t&.>$9*@>[email protected] DVVXPLQJ DOO LQSXW FORFN
MLWWHUVSHFLILFDWLRQVDUHVDWLVILHG)RUH[DPSOHWKHGHYLFHZLOOVXSSRUW
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
NOTES CONTINUED
tQ53Q&. 58t53t&.>$9*@LIDOOLQSXWFORFNMLWWHUVSHFLILFDWLRQV
DUHPHW7KLVPHDQVIRU''5RIZKLFK t53 QVWKH
GHYLFHZLOOVXSSRUWtQ53 58t53t&.>$9*@ DVORQJDVWKHLQSXW
FORFNMLWWHUVSHFLILFDWLRQVDUHPHW7KDWLVWKH35(&+$5*(FRPPDQG
DW7DQGWKH$&7,9$7(FRPPDQGDW7DUHYDOLGHYHQLIVL[FORFNV
DUHOHVVWKDQQVGXHWRLQSXWFORFNMLWWHU
32.
33.
$OWKRXJK &.( LV DOORZHG WR EH UHJLVWHUHG /2: DIWHU D 5()5(6+
FRPPDQGZKHQt5()3'(10,1LVVDWLVILHGWKHUHDUHFDVHVZKHUH
DGGLWLRQDOWLPHVXFKDVt;3'//0,1LVUHTXLUHG
'XULQJ 5($'V DQG :5,7(V ZLWK $872 35(&+$5*( WKH ''5
6'5$0 ZLOO KROG RII WKH LQWHUQDO 35(&+$5*( FRPPDQG XQWLO t5$6
0,1KDVEHHQVDWLVILHG
:KHQ RSHUDWLQJ LQ '// GLVDEOH PRGH WKH JUHDWHU RI &. RU QV LV
VDWLVILHGIRUt:5
7KHVWDUWRIWKHZULWHUHFRYHU\WLPHLVGHILQHGDVIROORZV
x)RU%/IL[HGE\056DQG27)5LVLQJFORFNHGJHIRXUFORFN
F\FOHVDIWHU:/
x)RU%&IL[HGE\0565LVLQJFORFNHGJHWZRFORFNF\FOHVDIWHU
:/
36.
+DOIFORFNRXWSXWSDUDPHWHUVPXVWGHUDWHGE\WKHDFWXDOt(553(5
and t-,7'7< ZKHQ LQSXW FORFN MLWWHU LV SUHVHQW 7KLV UHVXOWV LQ
HDFK SDUDPHWHU EHFRPLQJ ODUJHU 7KH SDUDPHWHUV t$'& 0,1 DQG
t$2)0,1DUHHDFKUHTXLUHGWREHGHUDWHGE\VXEWUDFWLQJERWKW(553(5 0$; DQG t-,7'7< 0$; 7KH SDUDPHWHUV t$'& 0$;
and t$2)0$;DUHUHTXLUHGWREHGHUDWHGE\VXEWUDFWLQJERWK t(553(50$;DQGt-,7'7<0$;
6KRXOGWKHFORFNUDWHEHODUJHUWKDQt5)&0,1DQ$8725()5(6+
FRPPDQG VKRXOG KDYH DW OHDVW RQH 123 FRPPDQG EHWZHHQ LW DQG
DQRWKHU $872 5()5(6+ FRPPDQG $GGLWLRQDOO\ LI WKH FORFN UDWH
LVVORZHUWKDQQV0+]DOO5()5(6+FRPPDQGVVKRXOGEHIROORZHGE\D35(&+$5*($//FRPPDQG
7KH UHIUHVK SHULRG LV PV ZKHQ T$ LV OHVV WKDQ RU HTXDO WR “&
7KLVHTXDWHVWRDQDYHUDJHUHIUHVKUDWHRI˜V+RZHYHUQLQH
5()5(6+FRPPDQGVVKRXOGEHDVVHUWHGDWOHDVWRQFHHYHU\˜V
:KHQT$LVJUHDWHUWKDQ“&WKHUHIUHVKSHULRGLVPVDQGZKHQ
T$LVJUHDWHUWKDQ“&WKHUHIUHVKSHULRGLVPV
www.logicdevices.com
39.
3XOVH ZLGWK RI DQ LQSXW VLJQDO LV GHILQHG DV WKH ZLGWK EHWZHHQ WKH
ILUVWFURVVLQJRI95()'&DQGWKHFRQVHFXWLYHFURVVLQJRI95()'&
5(6(7?VKRXOGEH/2:DVVRRQDVSRZHUVWDUWVWRUDPSWRHQVXUH
WKHRXWSXWVDUHLQ+,*+=8QWLO5(6(7?LV/2:WKHRXWSXWVDUHDWULVN
RIGULYLQJWKHEXVDQGFRXOGUHVXOWLQH[FHVVLYHFXUUHQWGHSHQGLQJRQ
WKHEXVDFWLYLW\
LOGIC Devices Incorporated
2'7WXUQRQWLPH0,1LVZKHQWKHGHYLFHOHDYHV+,*+=DQG2'7
UHVLVWDQFH EHJLQV WR WXUQ RQ 2'7 WXUQRQ WLPH PD[LPXP LV ZKHQ
WKH2'7UHVLVWDQFHLVIXOO\RQ7KH2'7UHIHUHQFHORDGLVVKRZQLQ
Figure 23.
2'7WXUQRIIWLPHPLQLPXPLVZKHQWKHGHYLFHVWDUWVWRWXUQRII2'7
UHVLVWDQFH2'7WXUQRIIWLPHPD[LPXPLVZKHQWKH6'5$0EXIIHU
LVLQ+,*+=7KH2'7UHIHUHQFHORDGLVVKRZQLQ)LJXUH7KLV
RXWSXWORDGLVXVHGIRU2'7WLPLQJVVHH)LJXUH
x)RU%&27)5LVLQJFORFNHGJHIRXUFORFNF\FOHVDIWHU:/
35.
38.
59
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
COMMAND AND ADDRESS SETUP, HOLD, AND DERATING
The total t,6VHWXSWLPHDQG t,+KROGWLPHUHTXLUHGLVFDOFXODWHGE\DGGLQJWKHGDWDVKHHW t,6EDVHDQG t,+EDVHYDOXHV7DEOHVWRWKH'tIS and 't,+
GHUDWLQJYDOXHV7DEOHUHVSHFWLYHO\6HWXSDQGKROGWLPHVDUHEDVHGRQPHDVXUHPHQWVDWWKHGHYLFH1RWHWKDWDGGUHVVDQGFRQWUROSLQVSUHVHQWWKH
FDSDFLWDQFHRIPXOWLSOHGLHWRWKHV\VWHP7KLVFDSDFLWDQFHLVOHVVWKDQWKHHTXLYDOHQWQXPEHURIGLVFUHWHGHYLFHVGXHWRWKHKLJKHUOHYHORIGLHLQWHJUDWLRQ
KRZHYHULWPXVWEHDFFRXQWHGIRUZKHQGULYLQJWKHVHSLQV6OHZUDWHVRQWKHVHSLQVZLOOEHVORZHUWKDQSLQVZLWKRQO\RQHGLHORDGXQOHVVPHDVXUHVDUHPDGH
WRLQFUHDVHWKHVWUHQJWKRIWKHVLJQDOGULYHUDQGORZHUWKHWUDFHLPSHGDQFHSURSRUWLRQDOO\RQVLJQDOVFRQQHFWLQJWRPXOWLSOHLQWHUQDOGLH
$OWKRXJKWKHWRWDOVHWXSWLPHIRUVORZVOHZUDWHVPLJKWEHQHJDWLYHDYDOLGLQSXWVLJQDOLVVWLOOUHTXLUHGWRFRPSOHWHWKHWUDQVLWLRQDQGWRUHDFK9,+$&9IL$&
VHH)LJXUHIRULQSXWVLJQDOUHTXLUHPHQWV)RUVOHZUDWHVZKLFKIDOOEHWZHHQWKHYDOXHVOLVWHGLQ7DEOHDQG7DEOHWKHGHUDWLQJYDOXHVPD\EHREWDLQHG
E\OLQHDULQWHUSRODWLRQ
6HWXSt,6QRPLQDOVOHZUDWHIRUDULVLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI95()'&DQGWKHILUVWFURVVLQJRI9,+$&0,16HWXS
t,6QRPLQDOVOHZUDWHIRUDIDOOLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI95()'&DQGWKHILUVWFURVVLQJRI9IL$&0$;,IWKHDFWXDO
VLJQDOLVDOZD\VHDUOLHUWKDQWKHQRPLQDOVOHZUDWHOLQHEHWZHHQWKHVKDGHGv95()'&WR$&UHJLRQwXVHWKHQRPLQDOVOHZUDWHIRUGHUDWLQJYDOXHVHH)LJXUH
,IWKHDFWXDOVLJQDOLVODWHUWKDQWKHQRPLQDOVOHZUDWHOLQHDQ\ZKHUHEHWZHHQWKHVKDGHGv95()'&WR$&UHJLRQwWKHVOHZUDWHRIDWDQJHQWOLQHWRWKH
DFWXDOVLJQDOIURPWKH$&OHYHOWRWKH'&OHYHOLVXVHGIRUWKHGHUDWLQJYDOXHVHH)LJXUH
+ROGt,+QRPLQDOVOHZUDWHIRUDULVLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI9IL'&0$;DQGWKHILUVWFURVVLQJRI95()'&+ROG
t,+QRPLQDOVOHZUDWHIRUDIDOOLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI9,+'&0,1DQGWKHILUVWFURVVLQJRI95()'&,IWKHDFWXDO
VLJQDOLVDOZD\VODWHUWKDQWKHQRPLQDOVOHZUDWHOLQHEHWZHHQWKHVKDGHGv'&WR95()'&UHJLRQwXVHWKHQRPLQDOVOHZUDWHIRUGHUDWLQJYDOXHVHH)LJXUH
,IWKHDFWXDOVLJQDOLVHDUOLHUWKDQWKHQRPLQDOVOHZUDWHOLQHDQ\ZKHUHEHWZHHQWKHVKDGHGw'&WR95()'&UHJLRQwWKHVOHZUDWHRIDWDQJHQWOLQHWRWKH
DFWXDOVLJQDOIURPWKH'&OHYHOWRWKH95()'&OHYHOLVXVHGIRUWKHGHUDWLQJYDOXHVHH)LJXUH
TABLE 48: COMMAND AND ADDRESS SETUP AND HOLD VALUES REFERENCED AT 1V/NS – AC/DC BASED
Symbol
DDR3-1333
DDR3-1600
DDR3-1866
UNITS
tIS(base)AC
600
600
-
SV
9,+$&9IL$&
tIS(base)AC
600
600
-
SV
9,+$&9IL$&
600
600
600
SV
9,+$&9IL$&
tIH(base)DC100
REFERENCE
TABLE 49: DERATING VALUES FOR tIS/tIH – AC175/DC100-BASED
Shaded cells indicate slew-rate combinations not supported
'tIS, 'tIH Derating (ps) - AC/DC-Based, AC175 Threshold; VIH(AC) = VREF(DC) + 175mV, VIL(AC) = VREF(DC) - 175mV
CMD/ADDR
Slew Rate V/ns
CK, CK\ Differential Slew Rate
4.0V/ns
3.0V/ns
2.0V/ns
1.8V/ns
1.6V/ns
1.4V/ns
1.2V/ns
1.0V/ns
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
2.0
88
50
88
50
88
50
96
58
96
66
112
120
128
100
1.5
59
50
59
50
83
58
91
68
99
1.0
0
0
0
0
0
0
8
8
8
16
32
50
0.9
-2
-2
-2
6
6
12
22
20
30
30
38
0.8
-6
-10
-6
-10
-6
-10
2
-2
2
6
18
26
-11
-16
-11
-16
-11
-16
-3
-8
-3
0
13
8
21
18
29
0.6
-26
-26
-26
-9
-18
-9
-10
-2
15
8
23
0.5
-35
-35
-35
-32
-11
-16
-2
-6
5
10
-62
-60
-62
-60
-62
-60
-52
-38
-36
-30
-26
-22
-10
LOGIC Devices Incorporated
www.logicdevices.com
60
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 50: DERATING VALUES FOR tIS/tIH – AC150/DC100-BASED
Shaded cells indicate slew-rate combinations not supported
'tIS, 'tIH Derating (ps) - AC/DC-Based, AC150 Threshold; VIH(AC) = VREF(DC) + 150mV, VIL(AC) = VREF(DC) - 150mV
CMD/ADDR
Slew Rate V/ns
CK, CK\ Differential Slew Rate
4.0V/ns
3.0V/ns
2.0V/ns
1.8V/ns
1.6V/ns
1.4V/ns
1.2V/ns
1.0V/ns
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
'tIS
'tIH
2.0
50
50
50
83
58
91
66
99
115
100
1.5
50
50
50
58
66
50
58
82
68
90
1.0
0
0
0
0
0
0
8
8
16
16
32
50
0.9
0
0
0
8
16
12
20
32
30
0.8
0
-10
0
-10
0
-10
8
-2
16
6
32
0
-16
0
-16
0
-16
8
-8
16
0
8
32
18
0.6
-1
-26
-1
-26
-1
-26
-18
15
-10
23
-2
31
8
39
0.5
-10
-10
-10
-2
-32
6
-16
22
-6
30
10
-25
-60
-25
-60
-25
-60
-52
-9
-1
-36
-26
15
-10
TABLE 51: MINIMUM REQUIRED TIME tVAC ABOVE VIH(AC) FOR A VALID TRANSITION
Below VIL(AC)
Slew Rate (V/ns)
tVAC
at 175mV(ps)
tVAC
at 150mV(ps)
tVAC
at 135mV(ps)
tVAC
at 125mV(ps)
>2.0
200
2.0
160
190
1.5
50
150
180
1.0
38
163
0.9
162
130
160
0.8
29
161
120
150
22
159
110
QD
0.6
13
155
105
QD
0.5
0
150
QD
QD
0
150
QD
QD
LOGIC Devices Incorporated
www.logicdevices.com
61
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 25 - NOMINAL SLEW RATE AND tVAC FOR tIS (COMMAND AND ADDRESS – CLOCK)
t IS
t IH
t IS
t IH
CK
CK#
DQS#
DQS
VDDQ
t VAC
VIH(AC) MIN
VREF to AC
region
VIH(DC) MIN
Nominal
slew rate
VREF(DC)
Nominal
slew rate
VIL(DC) MAX
VREF to AC
region
VIL(DC) MAX
t VAC
VSS
∆TF
Setup slew rate
falling signal
∆TR
VREF(DC) - VIL(AC) MAX
Setup slew rate
risin g signal
=
∆TF
Notes:
LOGIC Devices Incorporated
VIH(AC) MIN - V REF(DC)
=
∆TR
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
62
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 26 - NOMINAL SLEW RATE FOR tIH (COMMAND AND ADDRESS – CLOCK)
t IS
t IH
t IS
t IH
CK
CK#
DQS#
DQS
VDDQ
VIH(AC) MIN
VIH(DC) MIN
Nominal
slew rate
DC to V REF
region
VREF(DC)
Nominal
slew rate
DC to V REF
region
VIL(DC) MAX
VIL(AC) MAX
VSS
∆TF
∆TR
Hol d slew rate
=
rising signal
VREF(DC) - VIL(DC) MAX
Hol d slew rate
falling signal =
∆TR
Notes:
LOGIC Devices Incorporated
www.logicdevices.com
VIH(DC) MIN - V REF(DC)
∆TF
1. Both the clock and the strobe are drawn on different time scales.
63
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 27 - TANGENT LINE FOR tIS (COMMAND AND ADDRESS – CLOCK)
t IS
t IH
t IS
t IH
CK
CK#
DQS#
DQS
VDDQ
t VAC
Nominal
line
VIH(AC) MIN
VREF to AC
region
VIH(DC) MIN
Tangent
line
VREF(DC)
Tangent
line
VIL(DC) MAX
VREF to AC
region
VIL(AC) MAX
Nominal
line
t VAC
∆TR
VSS
Setup slew rate
rising signal =
∆TF
Notes:
LOGIC Devices Incorporated
Tangent line (V IH [ DC] MIN - VREF[ DC ])
∆TR
Tangent line (VREF [ DC] - V IL[ AC] MAX)
Setup slew rate
falling signal =
∆TF
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 28 - TANGENT LINE FOR tIH (COMMAND AND ADDRESS – CLOCK)
t IS
t IH
t IS
t IH
CK
CK#
DQS #
DQS
VDDQ
VIH(AC) MIN
Nominal
line
VIH(DC) MIN
DC to V REF
region
Tangent
line
VREF(DC)
DC to V REF
region
Tangent
line
Nominal
line
VIL( DC) MAX
VIL( AC) MAX
VSS
∆TR
∆TR
Hol d slew rate
rising signal =
Tangent line (V REF [ DC] - V IL[ DC] MAX)
Hol d slew rate
falling signal =
Tangent line (V IH [ DC] MIN - VREF[ DC])
∆TR
∆TF
Notes:
LOGIC Devices Incorporated
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
65
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
DATA SETUP, HOLD AND DERATING
The total t'6VHWXSWLPHDQGt'+KROGWLPHUHTXLUHGLVFDOFXODWHGE\DGGLQJWKHGDWDVKHHWt'6EDVHDQGt'+EDVHYDOXHVVHH7DEOHWRWKH'tDS and
't'+GHUDWLQJYDOXHVVHH7DEOHUHVSHFWLYHO\
$OWKRXJKWKHWRWDOVHWXSWLPHIRUVORZVOHZUDWHVPLJKWEHQHJDWLYHDYDOLGLQSXWVLJQDOLVVWLOOUHTXLUHGWRFRPSOHWHWKHWUDQVLWLRQDQGWRUHDFK9,+9IL$&)RU
VOHZUDWHVZKLFKIDOOEHWZHHQWKHYDOXHVOLVWHGLQ7DEOHWKHGHUDWLQJYDOXHVPD\EHREWDLQHGE\OLQHDULQWHUSRODWLRQ
6HWXSt'6QRPLQDOVOHZUDWHIRUDULVLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI95()'&DQGWKHILUVWFURVVLQJRI9,+$&0,16HWXS
t'6QRPLQDOVOHZUDWHIRUDIDOOLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI95()'&DQGWKHILUVWFURVVLQJRI9IL$&0$;,IWKHDFWXDO
VLJQDOLVDOZD\VHDUOLHUWKDQWKHQRPLQDOVOHZUDWHOLQHEHWZHHQWKHVKDGHGv95()'&WR$&UHJLRQwXVHWKHQRPLQDOVOHZUDWHGHUDWLQJYDOXHVHH)LJXUH
,IWKHDFWXDOVLJQDOLVODWHUWKDQWKHQRPLQDOVOHZUDWHOLQHDQ\ZKHUHEHWZHHQWKHVKDGHGv95()'&WR$&UHJLRQwWKHVOHZUDWHRIDWDQJHQWOLQHWRWKHDFWXDO
VLJQDOIURPWKH$&OHYHOWRWKH'&OHYHOLVXVHGIRUWKHGHUDWLQJYDOXHVHH)LJXUH
+ROGt'+QRPLQDOVOHZUDWHIRUDULVLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI9IL'&0$;DQGWKHILUVWFURVVLQJRI95()'&+ROG
t'+QRPLQDOVOHZUDWHIRUDIDOOLQJVLJQDOLVGHILQHGDVWKHVOHZUDWHEHWZHHQWKHODVWFURVVLQJRI9,+'&0,1DQGWKHILUVWFURVVLQJRI95()'&,IWKHDFWXDO
VLJQDOLVDOZD\VODWHUWKDQWKHQRPLQDOVOHZUDWHOLQHEHWZHHQWKHVKDGHGv'&WR95()'&UHJLRQwXVHWKHQRPLQDOVOHZUDWHIRUGHUDWLQJYDOXHVHH)LJXUH
,IWKHDFWXDOVLJQDOLVHDUOLHUWKDQWKHQRPLQDOVOHZUDWHOLQHDQ\ZKHUHEHWZHHQWKHVKDGHGv'&WR95()'&UHJLRQwWKHVOHZUDWHRIDWDQJHQWOLQHWRWKH
DFWXDOVLJQDOIURPWKHv'&WR95()'&UHJLRQwLVXVHGIRUWKHGHUDWLQJYDOXHVHH)LJXUH
TABLE 52: DATA SETUP AND HOLD VALUES AT 1V/NS (DQSX, DQSX\ AT 2V/NS) - AC/DC BASED
DDR3-1333
DDR3-1600
tDS(base)AC175
Symbol
-
-
DDR3-1866
-
UNITS
SV
REFERENCE
9,+$&9IL$&
tDS(base)AC175
-
-
-
SV
9,+$&9IL$&
tDS(base)DC150
30
10
10
SV
9,+$&9IL$&
tDS(base)DC150
65
SV
9,+$&9IL$&
TABLE 53: DERATING VALUE FOR tDS/tDH – AC175/DC100 - BASED
Shaded cells indicate slew-rate combinations not supported
ǻtDS, ǻtDH Derating (ps) – AC175/D100-Based
DQ
Slew Rate V/ns
DQS, DQS# Differential Slew Rate
4.0V/ns
3.0V/ns
2.0V/ns
1.8V/ns
1.6V/ns
1.4V/ns
1.2V/ns
1.0V/ns
'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH
2.0
88
50
88
50
88
50
1.5
59
59
59
1.0
0
0
0
0
0
0
8
8
16
16
-2
-2
6
12
22
20
-6
-10
2
-2
10
6
18
26
-3
-8
5
0
13
8
21
18
29
-1
-10
-2
15
8
23
-11
-16
0.9
0.8
0.6
0.5
LOGIC Devices Incorporated
www.logicdevices.com
66
-2
-6
5
10
-30
-26
-22
-10
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 54: DERATING VALUE FOR tDS/tDH – AC150/DC100 - BASED
Shaded cells indicate slew-rate combinations not supported
ǻtDS, ǻtDH Derating (ps) – AC150/DC100-Based
DQ Slew
Rate V/ns
DQS, DQS# Differential Slew Rate
4.0V/ns
3.0V/ns
2.0V/ns
1.8V/ns
1.6V/ns
1.4V/ns
1.2V/ns
1.0V/ns
'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH 'tDS 'tDH
2.0
50
50
50
1.5
50
50
50
58
1.0
0
0
0
0
0
0
8
8
16
16
0
0
8
16
12
20
0
-10
8
-2
16
6
32
8
-8
16
0
8
32
18
15
-10
23
-2
31
8
39
-16
22
-6
30
10
-26
15
-10
0.9
0.8
0.6
0.5
TABLE 55: REQUIRED TIME tVAC ABOVE VIH(AC) (BELOW VIL[AC]) FOR A VALID TRANSITION
tVAC
Slew Rate (V/ns)
at 175mV(ps) [MIN]
tVAC
at 150mV(ps) [MIN]
>2.0
2.0
1.5
50
1.0
38
163
0.9
162
0.8
29
161
22
159
0.6
13
155
0.5
0
150
0
150
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 29 - NOMINAL SLEW RATE AND tVAC FOR tDS (DQ – STROBE)
CK
CK#
DQS#
DQS
t DS
t DH
t DS
t DH
VDDQ
t VAC
VIH(AC) MIN
VREF to AC
region
VIH(DC) MIN
Nominal
slew rate
VREF(DC)
Nominal
slew rate
VIL(DC) MAX
VREF to AC
region
VIL(AC) MAX
t VAC
VSS
∆TF
Setup slew rate
=
rising signal
Notes:
LOGIC Devices Incorporated
∆TR
VREF(DC) - VIL(AC) MAX
∆TF
Setup slew rate
=
rising signal
VIH(AC) MIN - VREF (DC)
∆TR
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
68
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 30 - NOMINAL SLEW RATE FOR tDH (DQ – STROBE)
CK
CK#
DQS#
DQS
t DS
t DH
t DS
t DH
VDDQ
VIH(AC) MIN
VIH(DC) MIN
Nominal
slew rate
DC to V REF
region
VREF(DC)
Nominal
slew rate
DC to V REF
region
VIL(DC) MAX
VIL(AC) MAX
VSS
∆TF
∆TR
Hold slew rate
=
rising signal
Notes:
LOGIC Devices Incorporated
VREF(DC) - VIL(DC) MAX
∆TR
Hold slew rate
=
falling signal
VIH(DC) MIN - V REF(DC)
∆TF
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
69
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 31 - NOMINAL SLEW RATE AND tVAC FOR tDS (DQ – STROBE)
CK
CK#
DQS#
DQS
t DS
t DH
t DS
t DH
VDDQ
Nominal
line
t VAC
VIH(AC) MIN
VREF to AC
region
VIH(DC) MIN
Tangent
line
VREF(DC)
Tangent
line
VIL(DC) MAX
VREF to AC
region
VIL(AC) MAX
Nominal
line
t VAC
∆TR
VSS
Setup slew rate
rising signal
=
Tangent line (V IH[ AC ] MIN - V REF [ DC])
∆TR
∆TF
Setup slew rate
falling signal
=
Tangent line (V REF[ DC] - V IL[ AC] MAX)
∆TF
Notes:
LOGIC Devices Incorporated
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 32 - NOMINAL SLEW RATE FOR tDH (DQ – STROBE)
CK
CK#
DQS#
DQS
t DS
t DH
t DS
t DH
VDDQ
VIH(AC) MIN
Nominal
line
VIH(DC) MIN
DC to VREF
region
Tangent
line
VREF(DC)
DC to VREF
region
Tangent
line
Nominal
line
VIL(DC) MAX
VIL(AC) MAX
VSS
∆TR
Notes:
LOGIC Devices Incorporated
∆TF
Tangent line (V REF[ DC] - V IL[ DC] MAX)
Hol d slew rate
falling signal
=
Hol d slew rate
falling signal
=
∆TR
Tangent line (V IH [ DC] MIN - VREF[ DC])
∆TF
1. Both the clock and the strobe are drawn on different time scales.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
COMMANDS TRUTH TABLE
TABLE 56: TRUTH TABLE - COMMAND
PACKAGE OUTLINE DIMENSIONS
CKE
Function
Symbol
Prev
Cycle
Next
Cycle
CS\
RAS\
CAS\
WE\
BA[2:0]
An
A12
A10
A[11,0:0] Notes
Mode Register Set
MRS
+
+
L
L
L
L
%$
REFRESH
5()
+
+
L
L
L
+
9
9
9
9
9
SELF REFRESH entry
65(
+
L
L
L
L
+
9
9
9
9
9
6
SELF REFRESH exit
65;
L
+
+
L
9
+
9
+
9
+
9
9
9
9
9
35(
+
+
L
L
L
L
9%$
9
9
L
9
35($
+
+
L
L
L
L
9
9
9
+
9
$&7
+
+
L
L
L
+
%$
:5
+
+
L
+
+
L
%$
5)8
9
L
&$
8
%&27)
:56
+
+
L
+
+
L
%$
5)8
L
L
&$
8
BL8OTF
:56
+
+
L
+
+
L
%$
5)8
+
L
&$
8
BL8MRS
%&056
:5$3
+
+
L
+
+
L
%$
5)8
9
+
&$
8
%&27)
:5$36
+
+
L
+
+
L
%$
5)8
L
+
&$
8
BL8OTF
:5$36
+
+
L
+
+
L
%$
5)8
+
+
&$
8
BL8MRS
%&056
RD
+
+
L
+
+
+
%$
5)8
9
L
&$
8
%&27)
5'6
+
+
L
+
+
+
%$
5)8
L
L
&$
8
BL8OTF
RDS8
+
+
L
+
+
+
%$
5)8
+
L
&$
8
Single-Bank PRECHARGE
PRECHARGE all banks
Bank ACTIVATE
BL8MRS
%&056
WRITE
WRITE with AUTO
PRECHARGE
READ
READ with AUTO
PRECHARGE
5$
5'$3
+
+
L
+
+
+
%$
5)8
9
+
&$
8
%&27)
5'$36
+
+
L
+
+
+
%$
5)8
L
+
&$
8
BL8OTF
BL8MRS
%&056
5'$36
+
+
L
+
+
+
%$
5)8
+
+
&$
8
NO OPERATION
123
+
+
L
+
+
+
9
9
9
9
9
9
Device DESELECTED
'(6
+
+
+
;
;
;
;
;
;
;
;
3'(
+
+
9
+
9
+
9
+
9
10
POWER-DOWN entry
+
9
+
9
9
9
9
9
9
6
9
9
9
9
9
6,11
12
3';
L
+
L
+
L
+
ZQ CALIBRATION LONG
=4&/
+
+
L
+
+
L
;
;
;
+
;
ZQ CALIBRATION SHORT
=4&6
+
+
L
+
+
L
;
;
;
L
;
POWER-DOWN exit
L
127(6
1.
&RPPDQGVDUHGHILQHGE\VWDWHVRI&6?5$6?&$6?:(?DQG&.(DW
8.
WKHULVLQJHGJHRIWKHFORFN7KH06%RI%$5$DQG&$DUHGHYLFH
GHQVLW\DQGFRQILJXUDWLRQGHSHQGHQW
2.
%XUVW 5($'V RU :5,7(V FDQQRW EH WHUPLQDWHG RU LQWHUUXSWHG 056
IL[HGDQG27)%/%&DUHGHILQHGLQ05
9.
7KHSXUSRVHRIWKH123FRPPDQGLVWRSUHYHQWWKH6'5$0IURPUHJLVWHULQJDQ\XQZDQWHGFRPPDQGV$123ZLOOQRWWHUPLQDWHDQGRSHUD-
5(6(7?LV/2:HQDEOHGDQGXVHGRQO\IRUDV\QFKURQRXV5(6(77KXV
WLRQWKDWLVLQH[HFXWLRQ
5(6(7?PXVWEHKHOG+,*+GXULQJDQ\QRUPDORSHUDWLRQ
3.
7KHVWDWHRI2'7GRHVQRWDIIHFWWKHVWDWHVGHVFULEHGLQWKLVWDEOH
10.
7KH'(6DQG123FRPPDQGVSHUIRUPVLPLODUO\
2SHUDWLRQVDSSO\WRWKHEDQNGHILQHGE\WKHEDQNDGGUHVV)RU056%$
11.
7KH 32:(5'2:1 PRGH GRHV QRW SHUIRUP DQ\ 5()5(6+ RSHUDWLRQV
VHOHFWVRQHRIIRXUPRGHUHJLVWHUV
12.
=4 &$/,%5$7,21 /21* LV XVHG IRU HLWKHU =4,17 ILUVW =4&/ FRP-
5.
v9wPHDQVv+wRUv/wDGHILQHGORJLFOHYHODQGv;wPHDQVv'RQuW&DUHw
6.
6HH7DEOHIRUDGGLWLRQDOLQIRUPDWLRQRQ&.(WUDQVLWLRQ
PDQGGXULQJLQLWLDOL]DWLRQRU=423(5=4&/FRPPDQGDIWHULQLWLDOL]D-
6(/)5()5(6+H[LWLVDV\QFKURQRXV
WLRQ
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 57: TRUTH TABLE - CKE
CKE
Current State 3
(n-1)
(n)
Previous Cycle 4
Present Cycle 4
(RAS\, CAS\, WE\, CS\)
Command 5
Action 5
Notes
L
L
v'RQuW&DUHw
0DLQWDLQ32:(5'2:1
1,2
L
+
'(6RU123
32:(5'2:1H[LW
1,2
POWER-DOWN
SELF REFRESH
L
L
v'RQuW&DUHw
0DLQWDLQ6(/)5()5(6+
1,2
Bank(s) ACTIVE
+
+
'(6RU123
6(/)5()5(6+H[LW
1,2
READING
+
L
'(6RU123
$FWLYH32:(5'2:1HQWU\
1,2
WRITING
+
L
'(6RU123
32:(5'2:1HQWU\
1,2
PRECHARGING
+
L
'(6RU123
32:(5'2:1HQWU\
1,2
REFRESHING
+
L
'(6RU123
35(&+$5*(32:(5'2:1HQWU\
1,2
All Banks IDLE
+
L
'(6RU123
35(&+$5*(32:(5'2:1HQWU\
1,2,6
+
L
5()5(6+
6(/)5()5(6+
127(6
1.
$OOVWDWHVDQGVHTXHQFHVQRWVKRZQDUHLOOHJDORUUHVHUYHGXQOHVVH[SOLF-
LWO\GHVFULEHGHOVHZKHUHLQWKLVGRFXPHQW
2.
VWDWHRI&.(DWWKHSUHYLRXVFORFNHGJH
t&.(0,1PHDQV&.(PXVWEHUHJLVWHUHGDWPXOWLSOHFRQVHFXWLYHSRVL-
5.
&200$1'LVWKHFRPPDQGUHJLVWHUHGDWWKHFORFNHGJHPXVWEHD
WLYHFORFNHGJHV&.(PXVWUHPDLQDWWKHYDOLGLQSXWOHYHOWKHHQWLUHWLPH
OHJDO FRPPDQG DV GHILQHG LQ 7DEOH $FWLRQ LV D UHVXOW RI &20-
LWWDNHVWRDFKLHYHWKHUHTXLUHGQXPEHURIUHJLVWUDWLRQFORFNV7KXVDIWHU
0$1'2'7GRHVQRWDIIHFWWKHVWDWHVGHVFULEHGLQWKLVWDEOHDQGLV
DQ\&.(WUDQVLWLRQ&.(PD\QRWWUDQVLWLRQIURPLWVYDOLGOHYHOGXULQJWKH
WLPHSHULRGRIt,6t&.(0,1t,+
3.
&.(QLVWKHORJLFVWDWHRI&.(DWFORFNHGJHQ&.(QZDVWKH
QRWOLVWHG
6.
,GOHVWDWH DOOEDQNVDUHFORVHGQRGDWDEXUVWVDUHLQSURJUHVV&.(LV
&XUUHQWVWDWH 7KHVWDWHRIWKH6'5$0LPPHGLDWHO\SULRUWRFORFNHGJH
+,*+DQGDOOWLPLQJVIURPSUHYLRXVRSHUDWLRQVDUHVDWLVILHG$OO6(/)
n.
5()5(6+H[LWDQG32:(5'2:1H[LWSDUDPHWHUVDUHDOVRVDWLVILHG
NO OPERATION (NOP)
DESELECT (DES)
7KH'(6FRPPDQG&6?+,*+SUHYHQWVQHZFRPPDQGVIURPEHLQJH[HFXWHGE\WKH6'5$02SHUDWLRQVDOUHDG\LQSURJUHVVDUHQRWDIIHFWHG
7KH123FRPPDQG&6?/2:SUHYHQWVXQZDQWHGFRPPDQGVIURPEHLQJ
UHJLVWHUHG GXULQJ LGOH RU ZDLW VWDWHV 2SHUDWLRQV DOUHDG\ LQ SURJUHVV DUH
QRWDIIHFWHG
ZQ CALIBRATION
ZQ Calibration LONG (ZQCL)
7KH=4&/FRPPDQGLVXVHGWRSHUIRUPWKHLQLWLDOFDOLEUDWLRQGXULQJDSRZHUXSLQLWLDOL]DWLRQDQGUHVHWVHTXHQFH7KLVFRPPDQGPD\EHLVVXHGDWDQ\WLPHE\
WKHFRQWUROOHUGHSHQGLQJRQWKHV\VWHPHQYLURQPHQW7KH=4&/FRPPDQGWULJJHUVWKHFDOLEUDWLRQHQJLQHLQVLGHWKH6'5$0$IWHUFDOLEUDWLRQLVDFKLHYHGWKH
FDOLEUDWHGYDOXHVDUHWUDQVIHUUHGIURPWKHFDOLEUDWLRQHQJLQHWRWKH6'5$0,2ZKLFKDUHUHIOHFWHGDVXSGDWHG5ONDQG2'7YDOXHV
7KH6'5$0LVDOORZHGDWLPLQJZLQGRZGHILQHGE\HLWKHU t=4,1,7RU t=423(5WRSHUIRUPWKHIXOOFDOLEUDWLRQDQGWUDQVIHURIYDOXHV:KHQ=4&/LVLVVXHG
GXULQJWKHLQLWLDOL]DWLRQVHTXHQFHWKHWLPLQJSDUDPHWHUW=4,1,7PXVWEHVDWLVILHG:KHQLQLWLDOL]DWLRQLVFRPSOHWHVXEVHTXHQW=4&/FRPPDQGVUHTXLUHWKH
WLPLQJSDUDPHWHUt=423(5WREHVDWLVILHG
ZQ Calibration SHORT (ZQCS)
7KH=4&6FRPPDQGLVXVHGWRSHUIRUPSHULRGLFFDOLEUDWLRQVWRDFFRXQWIRUVPDOOYROWDJHDQGWHPSHUDWXUHYDULDWLRQV7KHVKRUWHUWLPLQJZLQGRZLVSURYLGHG
WRSHUIRUPWKHUHGXFHGFDOLEUDWLRQDQGWUDQVIHURIYDOXHVDVGHILQHGE\WLPLQJSDUDPHWHUt=4&6$=4&6FRPPDQGFDQHIIHFWLYHO\FRUUHFWDPLQLPXPRI
RON and RTTLPSHGDQFHHUURUVZLWKLQFORFNF\FOHVDVVXPLQJWKHPD[LPXPVHQVLWLYLWLHVVSHFLILHGLQ7DEOHDQG7DEOH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ACTIVATE
READ
7KH $&7,9$7( FRPPDQG LV XVHG WR RSHQ RU $&7,9$7( D URZ LQ D
SDUWLFXODU EDQN IRU D VXEVHTXHQW DFFHVV 7KH YDOXH RQ WKH %$ >@
LQSXWVVHOHFWVWKHEDQNDQGWKHDGGUHVVSURYLGHGRQLQSXWV$>[email protected]
WKHURZ7KLVURZUHPDLQVRSHQRU$&7,9(IRUDFFHVVHVXQWLOD35(&+$5*(FRPPDQGLVLVVXHGWRWKDWEDQN
7KH5($'FRPPDQGLVXVHGWRLQLWLDWHDEXUVW5($'DFFHVVWRDQ$&7,9(
URZ 7KH DGGUHVV SURYLGHG RQ LQSXWV $>@ VHOHFWV WKH VWDUWLQJ FROXPQ
DGGUHVVGHSHQGLQJRQWKHEXUVWOHQJWKDQGEXUVWW\SHVHOHFWHGVHHWDEOH
7KHYDOXHRQLQSXW$GHWHUPLQHVZKHWKHURUQRWDXWRSUHFKDUJHLV
XVHG,IDXWRSUHFKDUJHLVVHOHFWHGWKHURZEHLQJDFFHVVHGZLOOEH35(&+$5*('DWWKHHQGRIWKH5($'EXUVW,I$87235(&+$5*(LVQRW
VHOHFWHGWKHURZZLOOUHPDLQRSHQIRUVXEVHTXHQWDFFHVVHV7KHYDOXHRQ
LQSXW$LIHQDEOHGLQWKH02'(5(*,67(5ZKHQWKH5($'FRPPDQG
LVLVVXHGGHWHUPLQHVZKHWKHU%&FKRSRU%/LVXVHG$IWHUD5($'
FRPPDQGLVLVVXHGWKH5($'EXUVWPD\QRWEHLQWHUUXSWHG$VXPPDU\
RI5($'FRPPDQGVLVVKRZQLQ7DEOH
$35(&+$5*(FRPPDQGPXVWEHLVVXHGEHIRUHRSHQLQJDGLIIHUHQWURZ
LQWKHVDPHEDQN
TABLE 58: READ COMMAND SUMMARY
CKE
Function
READ
READ with AUTO
PRECHARGE
Symbol
Prev
Cycle
Next
Cycle
CS\
RAS\
CAS\
WE\
+
L
+
L
+
%$
5)8
+
L
+
L
+
%$
RDS8
+
L
+
L
+
%$
BL8MRS
%&056
5'$3
+
L
+
L
+
%&27)
5'$36
+
L
+
L
+
BL8OTF
5'$36
+
L
+
L
+
BL8MRS
%&056
RD
%&27)
5'6
BL8OTF
BA[2:0]
An
A12
A10
A[11,0:0] Notes
9
L
&$
5)8
L
L
&$
5)8
+
L
&$
%$
5)8
9
+
&$
%$
5)8
L
+
&$
%$
5)8
+
+
&$
WRITE
7KH:5,7(FRPPDQGLVXVHGWRLQLWLDWHDEXUVW:5,7(DFFHVVWRDQ$&7,9(URZ7KHYDOXHRQWKH%$>@LQSXWVVHOHFWVWKHEDQN7KHYDOXHRQLQSXW$
GHWHUPLQHVZKHWKHURUQRW$87235(&+$5*(LVXVHG7KHYDOXHRQLQSXW$LIHQDEOHGLQWKH02'(5(*,67(5>[email protected]:5,7(FRPPDQGLV
LVVXHGGHWHUPLQHVZKHWKHU%&FKRSRU%/LVXVHG7KH:5,7(FRPPDQGVXPPDU\LVVKRZQLQ7DEOH
TABLE 59: WRITE COMMAND SUMMARY
CKE
Function
Symbol
BL8MRS
%&056
WRITE
WRITE with AUTO
PRECHARGE
:5
Prev
Cycle
Next
Cycle
CS\
RAS\
CAS\
WE\
BA[2:0]
An
A12
A10
A[11,0:0] Notes
+
L
+
L
L
%$
5)8
9
L
&$
+
%&27)
:56
+
L
L
L
%$
5)8
L
L
&$
BL8OTF
:56
+
L
+
L
L
%$
5)8
+
L
&$
+
BL8MRS
%&056
:5$3
+
L
L
L
%$
5)8
9
+
&$
%&27)
:5$36
+
L
+
L
L
%$
5)8
L
+
&$
+
L
+
L
L
%$
5)8
+
+
&$
BL8OTF
LOGIC Devices Incorporated
:5$36
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
PRECHARGE
REFRESH
7KH35(&+$5*(FRPPDQGLVXVHGWR'($&7,9$7(WKHRSHQURZLQD
SDUWLFXODUEDQNRULQDOOEDQNV7KHEDQNVDUHDYDLODEOHIRUDVXEVHTXHQW
URZDFFHVVDWDVSHFLILHGWLPHt53DIWHUWKH35(&+$5*(FRPPDQGLV
LVVXHGH[FHSWLQWKHFDVHRIFRQFXUUHQW$87235(&+$5*($5($'RU
:5,7(FRPPDQGWRDGLIIHUHQWEDQNLVDOORZHGGXULQJFRQFXUUHQW$872
35(&+$5*(DVORQJDVLWGRHVQRWLQWHUUXSWWKHGDWDWUDQVIHULQWKHFXUUHQWEDQNDQGGRHVQRWYLRODWHDQ\RWKHUWLPLQJSDUDPHWHUV,QSXW$
GHWHUPLQHVZKHWKHURQHRUDOOEDQNVDUHSUHFKDUJHG,QWKHFDVHZKHUH
RQO\RQHEDQNLVUHFKDUJHG,QSXWV%$>@VHOHFWWKHEDQNRWKHUZLVH
%$>@DUHWUHDWHGDVv'RQuW&DUHw$IWHUDEDQNLV35(&+$5*('LWLV
LQWKHLGOHVWDWHDQGPXVWEHDFWLYDWHGSULRUWRDQ\5($'RU:5,7(FRPPDQGVEHLQJLVVXHGWRWKDWEDQN$35(&+$5*(FRPPDQGLVWUHDWHG
DVD123LIWKHUHLVQRRSHQURZLQWKDWEDQNLGOHVWDWHRULIWKHSUHYLRXVO\RSHQURZLVDOUHDG\LQWKHSURFHVVRISUHFKDUJLQJ+RZHYHUWKH
35(&+$5*(SHULRGLVGHWHUPLQHGE\WKHODVW35(&+$5*(FRPPDQG
LVVXHGWRWKHEDQN
5()5(6+LVXVHGGXULQJQRUPDORSHUDWLRQRIWKH6'5$0DQGLVDQDORJRXV
WR&$6?EHIRUH5$6?&%5UHIUHVKRU$8725()5(6+7KLVFRPPDQG
LVQRQSHUVLVWHQWVRLWPXVWEHLVVXHGHDFKWLPHD5()5(6+LVUHTXLUHG
7KH DGGUHVVLQJ LV JHQHUDWHG E\ WKH LQWHUQDO 5()5(6+ FRPPDQG 7KH
6'5$0UHTXLUHV5()5(6+F\FOHVDWDQDYHUDJHLQWHUYDORI˜VPD[LPXPZKHQ7$d“&RU˜V0$;ZKHQ7$d“&7KH5()5(6+SHULRG
EHJLQVZKHQWKH5()5(6+FRPPDQGLVUHJLVWHUHGDQGHQGV t5)&0,1
later.
7RDOORZIRULPSURYHGHIILFLHQF\LQVFKHGXOLQJDQGVZLWFKLQJEHWZHHQWDVNV
VRPHIOH[LELOLW\LQWKHDEVROXWH5()5(6+LQWHUYDOLVSURYLGHG$PD[LPXP
RIHLJKW5()5(6+FRPPDQGVFDQEHSRVWHGWRDQ\JLYHQ6'5$0PHDQLQJWKDWWKHPD[LPXPDEVROXWHLQWHUYDOEHWZHHQDQ\5()5(6+FRPPDQG
DQG WKH QH[W 5()5(6+ FRPPDQG LV QLQH WLPHV WKH PD[LPXP DYHUDJH
LQWHUYDO UHIUHVK UDWH 6(/) 5()5(6+ PD\ EH HQWHUHG ZLWK XS WR HLJKW
5()5(6+FRPPDQGVEHLQJSRVWHG$IWHUH[LWLQJ6(/)5()5(6+ZKHQ
HQWHUHGZLWKSRVWHG5()5(6+FRPPDQGVDGGLWLRQDOSRVWLQJRI5()5(6+
FRPPDQGV LV DOORZHG WR WKH H[WHQW WKH PD[LPXP QXPEHU RI FXPXODWLYH
SRVWHG5()5(6+FRPPDQGVERWKSUHDQGSRVW6(/)5()5(6+GRHV
QRWH[FHHGHLJKW5()5(6+FRPPDQGV
FIGURE 33 - REFRESH MODE
T0
T2
T1
T3
T4
Ta0
Ta1
Tb0
Tb1
Valid 1
Valid 1
NOP1
NOP1
Tb2
CK#
CK
t CK
t CH
t CL
Valid 1
CKE
Command
NOP 1
PRE
NOP 1
NOP 1
REF
NOP 1
REF 2
ACT
Address
RA
All banks
A10
RA
One bank
Bank(s) 3
BA[2:0]
BA
DQS, DQS# 4
DQ4
DM 4
t RP
t RFC (MIN)
t RFC 2
Indicates A Break in
Time Scale
Notes:
LOGIC Devices Incorporated
Don’t Care
1. NOP commands are shown for ease of illustration; other valid commands may be
possible at these times. CKE must be active during the PRECHARGE, ACTIVATE,
and REFRESH commands, but may be inactive at other times (see “Power-Down
Mode” on page 153).
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SELF REFRESH
7KH6(/)5()5(6+FRPPDQGLVXVHGWRUHWDLQGDWDLQWKH6'5$0HYHQLIWKHUHVWRIWKHV\VWHPLVSRZHUHGGRZQ:KHQLQWKH6(/)5()5(6+PRGHWKH
6'5$0UHWDLQVGDWDZLWKRXWH[WHUQDOFORFNLQJ7KH6(/)5()5(6+PRGHLVDOVRDFRQYHQLHQWPHWKRGXVHGWRHQDEOHGLVDEOHWKH'//DVZHOODVWRFKDQJH
WKHFORFNIUHTXHQF\ZLWKLQWKHDOORZHGV\QFKURQRXVRSHUDWLQJUDQJH$OOSRZHUVXSSO\LQSXWVLQFOXGLQJ95()&$DQG95()'4PXVWEHPDLQWDLQHGDWYDOLGOHYHOV
XSRQHQWU\H[LWDQGGXULQJ6(/)5()5(6+PRGHRSHUDWLRQ$OOSRZHUVXSSO\LQSXWVLQFOXGLQJ95()&$DQG95()'4PXVWEHPDLQWDLQHGDWYDOLGOHYHOVXSRQ
HQWU\H[LWDQGGXULQJ6(/)5()5(6+PRGHXQGHUFHUWDLQFRQGLWLRQV
x9VV95()'49DDLVPDLQWDLQHG
x95()'4LVYDOLGDQGVWDEOHSULRUWR&.(JRLQJEDFN+,*+
x7KHILUVW:5,7(RSHUDWLRQPD\QRWRFFXUHDUOLHUWKDQFORFNVDIWHU95()'4LVYDOLG
x$OORWKHU6(/)5()5(6+PRGHH[LWWLPHUHTXLUHPHQWVDUHPHW
DLL DISABLE MODE
,IWKH'//LVGLVDEOHGE\WKH02'(5(*,67(505>@FDQEHVZLWFKHGGXULQJLQLWLDOL]DWLRQRUODWHUWKH6'5$0LVWDUJHWHGEXWQRWJXDUDQWHHGWRRSHUDWH
VLPLODUO\WRWKH1250$/PRGHZLWKDIHZQRWDEOHH[FHSWLRQV
x
x
x
7KH6'5$0VXSSRUWVRQO\RQHYDOXHRI&$6ODWHQF\&/ DQGRQHYDOXHRI&$6:5,7(ODWHQF\&:/ '//',6$%/(PRGHDIIHFWVWKH5($'GDWDFORFNWRGDWDVWUREHUHODWLRQVKLSt'46&.EXWQRWWKH5($'GDWDWRGDWDVWUREHUHODWLRQVKLS
tDQSQ, t4+6SHFLDODWWHQWLRQLVQHHGHGWROLQHWKH5($'GDWDXSZLWKWKHFRQWUROOHUWLPHGRPDLQZKHQWKH'//LVGLVDEOHG
,Q1250$/RSHUDWLRQ'//RQ t'46&.VWDUWVIURPWKHULVLQJFORFNHGJH$/&/F\FOHVDIWHUWKH5($'FRPPDQG,Q'//',6$%/(
PRGH t'46&.VWDUWV$/ &/yF\FOHVDIWHUWKH5($'FRPPDQG$GGLWLRQDOO\ZLWKWKH'//GLVDEOHGWKHYDOXHRI t'46&.FRXOGEH
larger than t&.
7KH2'7IHDWXUHLVQRWVXSSRUWHGGXULQJ'//',6$%/(PRGHLQFOXGLQJG\QDPLF2'77KH2'7UHVLVWRUVPXVWEHGLVDEOHGE\FRQWLQXRXVO\UHJLVWHULQJWKH
2'7EDOO/2:E\SURJUDPPLQJ5TT_NORM MR1[9,6,2] and RTTB:505>@WRvwZKLOHLQ'//',6$%/(PRGH
6SHFLILFVWHSVPXVWEHIROORZHGWRVZLWFKEHWZHHQWKH'//HQDEOHDQG'//',6$%/(PRGHVGXHWRDJDSLQWKHDOORZHGFORFNUDWHVEHWZHHQWKHWZRPRGHV
t&.>$9*@0$;DQG t&.>'//',6$%/(@0,1UHVSHFWLYHO\7KHRQO\WLPHWKHFORFNLVDOORZHGWRFURVVWKLVFORFNUDWHJDSLVGXULQJ6(/)5()5(6+PRGH
7KXVWKHUHTXLUHGSURFHGXUHIRUVZLWFKLQJIURPWKH'//(1$%/(WR'//',6$%/(PRGHLVWRFKDQJHIUHTXHQF\FXULQJVHOIUHIUHVKVHH)LJXUH
1.
2.
3.
5.
6WDUWLQJIURPWKH,'/(VWDWHDOOEDQNVDUH35(&+$5*('DOOWLPLQJVDUHIXOILOOHG2'7LVWXUQHGRIIDQG5TT_NOM and RTTB:5DUH
+,*+=VHW05>@WRvwWR',6$%/(WKH'//
(QWHU6(/)5()5(6+PRGHDIWHUt02'KDVEHHQVDWLVILHG
$IWHUt&.65(LVVDWLVILHGFKDQJHWKHIUHTXHQF\WRWKHGHVLUHGFORFNUDWH
6(/)5()5(6+PD\EHH[LWHGZKHQWKHFORFNLVVWDEOHGZLWKWKHQHZIUHTXHQF\IRUt&.65;
7KH6'5$0ZLOOEHUHDG\IRULWVQH[WFRPPDQGLQWKH'//',6$%/(PRGHDIWHUWKHJUHDWHURItMRD or t02'KDVEHHQVDWLVILHG$=4&/
FRPPDQGVKRXOGEHLVVXHGZLWKDSSURSULDWHWLPLQJPHWDVZHOO
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
L9D3256M32DBG2
L9D3512M32DBG2
PRELIMINARY INFORMATION
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 34 - DLL ENABLE MODE TO DLL DISABLE MODE
T0
T1
Ta0
Ta1
Tb0
Tc0
Td0
Td1
Te0
Te1
Tf0
CK#
CK
Vali d 1
CKE
Command
MRS2
6
NOP
SRE 3
t MOD
SRX 4
NOP
t CKSRE
t CKSRX 8
7
NOP
MRS5
NOP
Vali d 1
t MOD
t XS
t CKESR
ODT 9
Vali d 1
Indicates a Break in
Time Scale
127(6
1.
$Q\YDOLGFRPPDQG
2.
'LVDEOH'//E\VHWWLQJ05>@WRvw
3.
:DLWt;6WKHQVHW05>@WRvwWRHQDEOH'//
:DLWt05'WKHQVHW05>@WRvwWREHJLQ'//5(6(7
5.
:DLWt05'XSGDWHUHJLVWHUV&/&:/DQGZULWHUHFRYHU\PD\EHQHFHVVDU\
6.
:DLWt02'DQ\YDOLGFRPPDQG
6WDUWLQJZLWKWKHLGOHVWDWH
8.
&KDQJHIUHTXHQF\
9.
&ORFNPXVWEHVWDEOHDWOHDVWt&.65;
10.
6WDWLF/2:LQFDVH5TT_NOM or RTTB:5LVHQDEOHGRWKHUZLVHVWDWLF/2:RU+,*+
Don ’t Care
$VLPLODUSURFHGXUHLVUHTXLUHGIRUVZLWFKLQJIURPWKH'//GLVDEOHPRGHEDFNWRWKH'//HQDEOHPRGH7KLVDOVRUHTXLUHVFKDQJLQJWKHIUHTXHQF\GXULQJVHOI
UHIUHVKPRGHVHH)LJXUHRQSDJH
6WDUWLQJIURPWKHLGOHVWDWHDOOEDQNVDUHSUHFKDUJHGDOOWLPLQJVDUHIXOILOOHG2'7LVWXUQHGRIIDQG5TT_NOM and RTTB:5DUH+LJK=
HQWHUVHOIUHIUHVKPRGH
$IWHUt&.65(LVVDWLVILHGFKDQJHWKHIUHTXHQF\WRWKHQHZFORFNUDWH
6HOIUHIUHVKPD\EHH[LWHGZKHQWKHFORFNLVVWDEOHZLWKWKHQHZIUHTXHQF\IRUt&.65;$IWHUt;6LVVDWLVILHGXSGDWHWKHPRGHUHJLVWHUV
ZLWKWKHDSSURSULDWHYDOXHV$WDPLQLPXPVHW05>@WRvwWRHQDEOHWKH'//:DLWt05'WKHQVHW05>@WRvwWRHQDEOH'//5(6(7
$IWHUDQRWKHUt05'GHOD\LVVDWLVILHGWKHQXSGDWHWKHUHPDLQLQJPRGHUHJLVWHUVZLWKWKHDSSURSULDWHYDOXHV
7KH'5$0ZLOOEHUHDG\IRULWVQH[WFRPPDQGLQWKH'//HQDEOHPRGHDIWHUWKHJUHDWHURItMRD or t02'KDVEHHQVDWLVILHG+RZHYHU
EHIRUHDSSO\LQJDQ\FRPPDQGRUIXQFWLRQUHTXLULQJDORFNHG'//DGHOD\RIt'//.DIWHU'//5(6(7PXVWEHVDWLVILHG$=4&/FRPPDQG
VKRXOGEHLVVXHGZLWKWKHDSSURSULDWHWLPLQJVPHWDVZHOO
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 35- DLL DISABLE MODE TO DLL ENABLE MODE
T0
Ta0
Ta1
Tb0
Tc0
Tc1
Td0
Te0
Tf0
Tg0
Th0
CK#
CK
CKE
Vali d
t DLLK
Command
SRE1
NOP
SRX2
NOP
t CKSRE
7
t CKSRX 9
8
MRS3
t XS
MRS4
t MRD
MRS5
Vali d 6
t MRD
ODTL off + 1 × t CK
t CKESR
ODT10
Indicates a Break in
Time Scale
Don ’t Care
127(6
1.
(QWHU6(/)5()5(6+
2.
([LW6(/)5()5(6+
3.
:DLWt;6WKHQVHW05>@WRvwWRHQDEOH'//
:DLWt05'WKHQVHW05>@WRvwWREHJLQ'//5(6(7
5.
:DLWt05'XSGDWHUHJLVWHUV&/&:/DQGZULWHUHFRYHU\PD\EHQHFHVVDU\
6.
:DLWt02'DQ\YDOLGFRPPDQG
6WDUWLQJZLWKWKHLGOHVWDWH
8.
&KDQJHIUHTXHQF\
9.
&ORFNPXVWEHVWDEOHDWOHDVWt&.65;
10.
6WDWLF/2:LQFDVH5TT_NOM or RTTB:5LVHQDEOHGRWKHUZLVHVWDWLF/2:RU+,*+
7KHFORFNIUHTXHQF\UDQJHIRUWKH'//GLVDEOHPRGHLVVSHFLILHGE\WKHSDUDPHWHU t&.'//B',6'XHWRODWHQF\FRXQWHUDQGWLPLQJUHVWULFWLRQVRQO\&/ DQG&:/ DUHVXSSRUWHG
'//GLVDEOHPRGHZLOODIIHFWWKHUHDGGDWDFORFNWRGDWDVWUREHUHODWLRQVKLSt'46&.EXWQRWWKHGDWDVWUREHWRGDWDUHODWLRQVKLStDQSQ, t4+6SHFLDODWWHQWLRQLVQHHGHGWRWKHFRQWUROOHUWLPHGRPDLQ
&RPSDUHGWRWKH'//RQPRGHZKHUH t'46&.VWDUWVIURPWKHULVLQJFORFNHGJH$/&/F\FOHVDIWHUWKH5($'FRPPDQGWKH'//GLVDEOHPRGH t'46&.
VWDUWV$/&/F\FOHVDIWHUWKH5($'FRPPDQGVHH)LJXUHRQSDJH
:5,7(RSHUDWLRQVIXQFWLRQVLPLODUO\EHWZHHQWKH'//HQDEOHDQG'//GLVDEOHPRGHVKRZHYHU2'7IXQFWLRQDOLW\LVQRWDOORZHGZLWK'//GLVDEOHPRGH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 36 - DLL DISABLE tDQSCK TIMING
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
T10
READ
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
Add ress
Vali d
RL = AL + C L = 6 (C L = 6, AL = 0)
CL = 6
DQS, DQS# DLL on
DI
b
DQ BL8 DLL on
DI
b+1
DI
b+2
DI
b+3
DI
b+4
DI
b+5
DI
b+6
DI
b+7
RL (DLLdisable) = AL + (C L - 1) = 5
t DQSCK (DLL_DIS) MIN
DQS, DQS# DLL off
DI
b
DQ BL8 DLL disable
DI
b+1
DI
b+2
DI
b+3
DI
b+4
DI
b+5
DI
b+6
DI
b+7
DI
b+3
DI
b+4
DI
b+5
DI
b+6
t DQSCK (DLL_ DIS) MAX
DQS, DQS# DLL off
DI
b
DQ BL8 DLL disable
DI
b+1
DI
b+2
DI
b+7
Transitioning Data
Don ’t Care
INPUT CLOCK FREQUENCY CHANGE
:KHQWKH''56'5$0LVLQLWLDOL]HGLWUHTXLUHVWKHFORFNWREHVWDEOHGXULQJPRVW1250$/VWDWHVRIRSHUDWLRQ7KLVPHDQVWKDWDIWHUWKHFORFNIUHTXHQF\
KDVEHHQVHWWRWKHVWDEOHVWDWHWKHFORFNSHULRGLVQRWDOORZHGWRGHYLDWHH[FHSWZKDWLVDOORZHGIRUE\WKHFORFNMLWWHUDQGVSUHDGVSHFWUXPFORFNLQJ66&
VSHFLILFDWLRQV
7KHLQSXWFORFNIUHTXHQF\FDQEHFKDQJHGIURPRQHVWDEOHFORFNUDWHWRDQRWKHUXQGHUWZRFRQGLWLRQV6(/)5()5(6+PRGHDQG35(&+$5*(SRZHUGRZQ
PRGH2XWVLGHRIWKHVHWZRPRGHVLWLVLOOHJDOWRFKDQJHWKHFORFNIUHTXHQF\)RUWKH6(/)5()5(6+PRGHFRQGLWLRQZKHQWKH''56'5$0KDVEHHQ
VXFFHVVIXOO\SODFHGLQWR6(/)5()5(6+PRGHDQG t&.65(KDVEHHQVDWLVILHGWKHVWDWHRIWKHFORFNEHFRPHVDv'RQuW&DUHw:KHQWKHFORFNEHFRPHVD
v'RQuW&DUHwFKDQJLQJWKHFORFNIUHTXHQF\LVSHUPLVVLEOHSURYLGHGWKHQHZFORFNIUHTXHQF\LVVWDEOHSULRUWRt&.65;:KHQHQWHULQJDQGH[LWLQJVHOIUHIUHVK
PRGHIRUWKHVROHSXUSRVHRIFKDQJLQJWKHFORFNIUHTXHQF\WKH6(/)5()5(6+HQWU\DQGH[LWVSHFLILFDWLRQVPXVWVWLOOEHPHW
7KH35(&+$5*(SRZHUGRZQPRGHFRQGLWLRQLVZKHQWKH''56'5$0LVLQ35(&+$5*(SRZHUGRZQPRGHHLWKHUIDVWH[LWPRGHRUVORZH[LWPRGH
(LWKHU2'7PXVWEHDWDORJLF/2:RU5TT_NOM and RTTB:5PXVWEHGLVDEOHGYLD05DQG057KLVHQVXUHV5TT_NOM and RTTB:5DUHLQDQRIIVWDWH
SULRUWRHQWHULQJ35(&+$5*(SRZHUGRZQPRGHZKLOHPDLQWDLQLQJ&.(DWDORJLF/2:$PLQLPXPRIt&.65(PXVWRFFXUDIWHU&.(JRHV/2:EHIRUHWKH
FORFNIUHTXHQF\FDQFKDQJH7KH''56'5$0LQSXWFORFNIUHTXHQF\LVDOORZHGWRFKDQJHRQO\ZLWKLQWKHPLQLPXPDQGPD[LPXPRSHUDWLQJIUHTXHQF\VSHFLILHGIRUWKHSDUWLFXODUVSHHGWHPSHUDWXUHJUDGHt&.>$9*@0,1WRt&.>$9*@0$;GHYLFH'XULQJWKHLQSXWFORFNIUHTXHQF\FKDQJH&.(PXVWEHKHOGDWD
VWDEOH/2:OHYHO:KHQWKHLQSXWFORFNIUHTXHQF\LVFKDQJHGDVWDEOHFORFNPXVWEHSURYLGHGWRWKH6'5$0t&.65;EHIRUH35(&+$5*(SRZHUGRZQPD\
EHH[LWHG$IWHU35(&+$5*(SRZHUGRZQLVH[LWHGDQGt;3KDVEHHQVDWLVILHGWKH'//PXVWEHUHVHWYLDWKH056'HSHQGLQJRQWKHQHZFORFNIUHTXHQF\
DGGLWLRQDO056FRPPDQGVPD\QHHGWREHLVVXHG'XULQJWKH'//ORFNWLPH5TT_NOM and RTTB:5PXVWUHPDLQLQDQRIIVWDWH$IWHUWKH'//ORFNWLPH
WKH6'5$0LVUHDG\WRRSHUDWHZLWKDQHZFORFNIUHTXHQF\SHULRG7KLVSURFHVVLVGHSLFWHGLQ)LJXUH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 37- CHANGE FREQUENCY DURING PRECHARGE POWER-DOWN
Previous clock frequency
T0
T1
T2
New clock fre quency
Ta0
Tb0
Tc1
Tc0
Td0
Td1
Te0
Te1
CK#
CK
t CH
t CL
t CH
t CK
t CK
t CKSRE
t IS
t IH
t CH
b
t CK
b
t CL
b
t CH
b
b
b
t CL
t CK
b
b
t CKSRX
t CKE
t IH
CKE
t IS
t CPDED
Command
t CL
b
NOP
NOP
NOP
NOP
NOP
Address
MRS
Valid
NOP
Valid
DLL RESET
t AOFPD/ t AOF
t XP
t IH
t IS
ODT
DQS, DQS#
High-Z
High-Z
DQ
DM
t DLLK
Enter precharge
power-down mode
Frequency
change
Exit precharge
power-down mode
Indicates a Break in
Time Scale
Don’t Care
127(6
1.
$SSOLFDEOHIRUERWKVORZH[LWDQGIDVWH[LWSUHFKDUJHSRZHUGRZQPRGHV
2.
t$2)3' DQG t$2) PXVW EH VDWLVILHG DQG RXWSXWV +LJK= SULRU WR 7 VHH v2Q'LH 7HUPLQDWLRQ
2'7wRQSDJHIRUH[DFWUHTXLUHPHQWV
3.
,IWKH5TTB120IHDWXUHZDVHQDEOHGLQWKHPRGHUHJLVWHUSULRUWRHQWHULQJSUHFKDUJHSRZHUGRZQ
PRGH WKH 2'7 VLJQDO PXVW EH FRQWLQXRXVO\ UHJLVWHUHG /2: HQVXULQJ 5TT LV LQ DQ RII VWDWH ,I
the RTTB120IHDWXUHZDVGLVDEOHGLQWKHPRGHUHJLVWHUSULRUWRHQWHULQJSUHFKDUJHSRZHUGRZQ
PRGH5TTZLOOUHPDLQLQWKHRIIVWDWH7KH2'7VLJQDOFDQEHUHJLVWHUHGHLWKHU/2:RU+,*+LQ
WKLVFDVH
LOGIC Devices Incorporated
www.logicdevices.com
80
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
WRITE LEVELING
)RUEHWWHUVLJQDOLQWHJULW\''56'5$0PHPRU\VXEV\VWHPGHVLJQVKDYHDGRSWHGXVHRIIO\E\WRSRORJ\IRUWKHFRPPDQGVDGGUHVVHVFRQWUROVLJQDOVDQG
FORFNV:5,7(OHYHOLQJLVDVFKHPHIRUWKHPHPRU\FRQWUROOHUWRGHVNHZWKH'46[VWUREH'46['46[?WR&.UHODWLRQVKLSDWWKH6'5$0ZLWKDVLPSOH
IHHGEDFNIHDWXUHSURYLGHGLWE\WKH''56'5$0LWVHOI:5,7(OHYHOLQJLVJHQHUDOO\XVHGDVSDUWRIWKHLQLWLDOL]DWLRQSURFHVVLIUHTXLUHG)RU1250$/
6'5$0RSHUDWLRQWKLVIHDWXUHPXVWEHGLVDEOHG7KLVLVWKHRQO\6'5$0RSHUDWLRQZKHUHWKH'46IXQFWLRQVDVDQLQSXWWRFDSWXUHWKHLQFRPLQJFORFNDQG
WKH'4VIXQFWLRQDVRXWSXWVWRUHSRUWWKHVWDWRIWKHFORFN1RWHWKDWQRQVWDQGDUG2'7VFKHPHVDUHUHTXLUHG
7KHPHPRU\FRQWUROOHUXVLQJWKH:5,7(OHYHOLQJSURFHGXUHPXVWKDYHDGMXVWDEOHGHOD\VHWWLQJRQLWV'46VWUREHWRDOLJQWKHULVLQJHGJHRI'46WRWKHFORFN
DWWKH6'5$0SLQV7KLVLVDFFRPSOLVKHGZKHQWKH6'5$0DV\QFKURQRXVO\IHHGVEDFNWKH&.VWDWXVYLDWKH'4EXVDQGVDPSOHVZLWKWKHULVLQJHGJHRI
'467KHFRQWUROOHUUHSHDWHGO\GHOD\VWKH'46VWUREHXQWLOD&.WUDQVLWLRQIURPvwWRvwLVGHWHFWHG7KH'46GHOD\HVWDEOLVKHGWKURXJKWKLVSURFHGXUH
KHOSVHQVXUHtDQSS, tDSS, and t'6+VSHFLILFDWLRQVLQV\VWHPVWKDWXVHIO\E\WRSRORJ\E\GHVNHZLQJWKHWUDFHOHQJWKPLVPDWFK$FRQFHSWXDOWLPLQJRIWKLV
SURFHGXUHLVVKRZQLQ)LJXUH
FIGURE 38- WRITE LEVELING CONCEPT
T0
T1
T2
T3
T4
T5
T6
T7
CK#
CK
Source
Differential DQS
Tn
T0
T1
T2
T3
T4
T5
T4
T5
T6
CK#
CK
Destination
Differential DQS
0
DQ
Destination
Tn
T0
T1
0
T2
T3
T6
CK#
CK
Push DQS to capture
0–1 transition
Differential DQS
1
DQ
1
Don’t Care
LOGIC Devices Incorporated
www.logicdevices.com
81
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
WRITE LEVELING
:KHQ:5,7(OHYHOLQJLVHQDEOHGWKHULVLQJHGJHRI'46VDPSOHV&.DQGWKHULPH'4RXWSXWVWKHVDPSOHG&.uVVWDWXV7KHSULPH'4IRUHDFKRIWKH
ZRUGVFRQWDLQHGLQWKHL02'LV'4IRUWKHORZE\WH'4IRUWKHKLJKE\WH,WRXWSXWVWKHVWDWXVRI&.VDPSOHGE\/'46[DQG8'46[$OORWKHU'4V
'4>@'4>@IRUWKHORZZRUG'4>@'4>@IRUWKHQH[WZRUG'4>@'4>@IRUWKHQH[WDQG'4>@'4>@IRUWKH+,*+ZRUG
FRQWLQXHWRGULYH/2:7ZRSULPH'4RQHDFKRIWKHZRUGVFRQWDLQHGLQWKH/',L02'DOORZHDFKE\WHODQHWREHOHYHOHGLQGHSHQGHQWO\
WRITE LEVELING PROCEDURE
$PHPRU\FRQWUROOHULQLWLDWHVWKH6'5$0:5,7(/HYHOLQJPRGHE\VHWWLQJWKH05>@WRDvwDVVXPLQJWKHRWKHUSURJUDPPDEOHIHDWXUHV050505
DQG05DUHILUVWVHWDQGWKH'//LVIXOO\UHVHWDQGORFNHG7KH'4EDOOVHQWHUWKH:5,7(/HYHOLQJPRGHJRLQJIURPDv+,*+=wVWDWHWRDQXQGHILQHGGULYLQJVWDWHVRWKH'4EXVVKRXOGQRWEHGULYHQ'XULQJ:5,7(/HYHOLQJPRGHRQO\WKH123DQG'(6FRPPDQGVDUHDOORZHG7KHPHPRU\FRQWUROOHUVKRXOG
DWWHPSWWROHYHORQO\RQHUDQNDWDWLPHWKXVWKHRXWSXWVRIRWKHUUDQNVVKRXOGEHGLVDEOHGE\VHWWLQJ05>@WRDvw7KHPHPRU\FRQWUROOHUPD\DVVHUW
2'7DIWHUDt02'GHOD\DVWKH6'5$0ZLOOEHUHDG\WRSURFHVVWKH2'7/RQGHOD\:/t&.SURYLGHGLWGRHVQRWYLRODWHWKHDIRUHPHQWLRQHG t02'GHOD\
UHTXLUHPHQW
7KHPHPRU\FRQWUROOHUPD\GULYH/'46[8'46[/2:DQG/'46[?8'46[?+,*+DIWHUt:/'46(1KDVEHHQVDWLVILHG7KHFRQWUROOHUPD\EHJLQWRWRJJOH
/'46[8'46[DIWHUt:/05'RQH/>[email protected]'46VWRJJOHLV'46VWUDQVLWLRQLQJIURPD/2:VWDWHWRD+,*+VWDWHZLWK/>[email protected]'46[?WUDQVLWLRQLQJIURPD+,*+VWDWH
WRD/2:VWDWHWKHQERWKWUDQVLWLRQEDFNWRWKHLURULJLQDOVWDWHV$WDPLQLPXP2'7/RQDQGt$21PXVWEHVDWLVILHGDWOHDVWRQHFORFNSULRUWR'46WRJJOLQJ
$IWHUt:/05'DQG'46/2:SUHDPEOHt:35(KDYHEHHQVDWLVILHGWKHPHPRU\FRQWUROOHUPD\SURYLGHHLWKHUDVLQJOH'46[WRJJOHRUPXOWLSOH'46[WRJJOHV
WRVDPSOH&.IRUDJLYHQ'46[WR&.VNHZ(DFK'46WRJJOHPXVWQRWYLRODWHt'46/0,1DQGt'46+0,1VSHFLILFDWLRQVt'46/0$;DQGt'46+0$;
VSHFLILFDWLRQVDUHQRWDSSOLFDEOHGXULQJ:5,7(OHYHOLQJPRGH7KH'46[PXVWEHDEOHWRGLVWLQJXLVKWKH&.uVULVLQJHGJHZLWKLQt:/6DQGt:/+7KHSULPH
'4ZLOORXWSXWWKH&.uVVWDWXVDV\QFKURQRXVO\IURPWKHDVVRFLDWHG'46[ULVLQJHGJH&.FDSWXUHZLWKLQ t:/27KHUHPDLQLQJ'4VWKDWDOZD\VGULYH/2:
ZKHQ'46LVWRJJOLQJPXVWEH/2:ZLWKLQt:/2(DIWHUWKHILUVWt:/2LVVDWLVILHGWKHSULPH'4VJRLQJ/2:$VSUHYLRXVO\QRWHG'46[LVDQLQSXWDQGQRW
DQRXWSXWGXULQJWKLVSURFHVV)LJXUHGHSLFWVWKHEDVLFWLPLQJSDUDPHWHUVIRUWKHRYHUDOOZULWHOHYHOLQJSURFHGXUH
7KHPHPRU\FRQWUROOHUZLOOOLNHO\VDPSOHHDFKDSSOLFDEOHSULPH'4VWDWHDQGGHWHUPLQHZKHWKHUWRLQFUHPHQWRUGHFUHPHQWLW'46GHOD\VHWWLQJ$IWHUWKH
PHPRU\FRQWUROOHUSHUIRUPVHQRXJK'46[WRJJOHVWRGHWHFWWKH&.uVvwWUDQVLWLRQWKHPHPRU\FRQWUROOHUVKRXOGORFNWKH'46GHOD\VHWWLQJIRUWKH6'5$0
L02'GHYLFH$IWHUORFNLQJWKH'46VHWWLQJOHYHOLQJIRUWKHUDQNZLOOKDYHEHHQDFKLHYHGDQGWKH:5,7(OHYHOLQJPRGHIRUWKHUDQNVKRXOGEHGLVDEOHGRU
UHSURJUDPPHGLI:5,7(OHYHOLQJRIDQRWKHUUDQNIROORZV
LOGIC Devices Incorporated
www.logicdevices.com
82
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 39- WRITE LEVELING SEQUENCE
T1
T2
t WLS
t WLH
CK#
CK
Command
MRS1
NOP2
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
t MOD
ODT
t WLDQSEN
t DQSL3
t DQSH3
t DQSL3
t DQSH3
Differential DQS4
t WLMRD
t WLO
t WLO
Prime DQ 5
t WLO
t WLOE
Early remaining DQ
t WLO
Late remaining DQ
Indicates a Break in
Time Scale
Undefined Driving Mode
Don’t Care
127(6
1.
056/RDG05WRHQWHUZULWHOHYHOLQJPRGH
2.
123123RU'(6
3.
'46'46QHHGVWRIXOILOOPLQLPXPSXOVHZLGWKUHTXLUHPHQWV t'46+0,1DQG t'46/0,1DV
GHILQHGIRUUHJXODUZULWHV7KHPD[LPXPSXOVHZLGWKLVV\VWHPGHSHQGHQW
'LIIHUHQWLDO'46LVWKHGLIIHUHQWLDOGDWDVWUREH'46'467LPLQJUHIHUHQFHSRLQWVDUHWKH]HUR
FURVVLQJV7KHVROLGOLQHUHSUHVHQWV'46WKHGRWWHGOLQHUHSUHVHQWV'46
5.
'5$0GULYHVOHYHOLQJIHHGEDFNRQDSULPH'4'4IRU[DQG[7KHUHPDLQLQJ'4DUHGULYHQ
/2:DQGUHPDLQLQWKLVVWDWHWKURXJKRXWWKHOHYHOLQJSURFHGXUH
WRITE LEVELING EXIT MODE
$IWHUWKH''56'5$0L02'KDVEHHQ:5,7(OHYHOHGWKHFRQWUROOHUPXVWH[LWIURP:5,7(/HYHOLQJPRGHEHIRUHWKH1250$/PRGHFDQEHXVHG)LJXUH
GHSLFWVDJHQHUDOSURFHGXUHLQH[LWLQJ:5,7(/HYHOLQJ$IWHUWKHODVWULVLQJ'46FDSWXULQJDvwDW7WKHPHPRU\FRQWUROOHUVKRXOGVWRSGULYLQJWKH'46
VLJQDOVDIWHUt:/20$;GHOD\SOXVHQRXJKGHOD\WRHQDEOHWKHPHPRU\FRQWUROOHUWRFDSWXUHWKHDSSOLFDEOHSULPH'4VWDWHDWy7E7KH'4EDOOVEHFRPH
XQGHILQHGZKHQ'46QRORQJHUUHPDLQV/2:DQGWKH\UHPDLQXQGHILQHGXQWLOt02'DIWHUWKH056FRPPDQGDW7H
7KH2'7LQSXWVKRXOGEHGHDVVHUWHG/2:VXFKWKDW2'7/RII0,1H[SLUHVDIWHUWKH'46[LVQRORQJHUGULYLQJ/2::KHQ2'7/2:VDWLVILHV tIS, ODT
PXVWEHNHSW/2:DWy7EXQWLOWKH6'5$0LVUHDG\IRUHLWKHUDQRWKHUUDQNWREHOHYHOHGRUXQWLOWKH1250$/PRGHFDQEHXVHG$IWHU'46WHUPLQDWLRQLV
VZLWFKHGRII:5,7(OHYHOPRGHVKRXOGEHGLVDEOHGYLDWKH056FRPPDQGDWT$$IWHUt02'LVVDWLVILHGDW7HDQ\YDOLGFRPPDQGPD\EHUHJLVWHUHG
E\WKH6'5$06RPH056FRPPDQGVPD\EHLVVXHGDIWHUt05'DW7G
LOGIC Devices Incorporated
www.logicdevices.com
83
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 40- EXIT WRITE LEVELING
T0
T1
T2
Ta0
Tb0
Tc0
Tc1
Tc2
Td0
Td1
Te0
Te1
NOP
NOP
NOP
NOP
NOP
NOP
NOP
M RS
NOP
t MRD
Valid
NOP
Valid
CK#
CK
Command
Add ress
Valid
MR1
t IS
Valid
t MOD
ODT
ODTL off
R TT DQS, R TT DQS#
t AOF (MIN)
RTT_NOM
t AOF (MAX)
DQS, DQS#
RTT_DQ
t WLO + t WLOE
DQ
CK = 1
Indicates a Break in
Time Scale
Undefined Driving Mode
Transitioning
Don ’t Care
Notes: 1. The DQ result, “= 1,” between Ta0 and Tc0, is a result of the DQS, DQS# signals capturing
CK HIGH just after the T0 state.
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OPERATIONS
Initialization
7KHIROORZLQJVHTXHQFHLVUHTXLUHGIRUSRZHUXSDQGLQLWLDOL]DWLRQDVVKRZQLQ)LJXUH
1.
$SSO\SRZHU5(6(7?LVUHFRPPHQGHGWREHEHORZ[9DD4GXULQJSRZHUUDPSWRHQVXUHWKHRXWSXWVUHPDLQGLVDEOHG+,*+=DQG
2'7RII5TTLVDOVR+,*+=$OORWKHULQSXWVLQFOXGLQJ2'7PD\EHXQGHILQHG
'XULQJSRZHUXSHLWKHURIWKHIROORZLQJFRQGLWLRQVPD\H[LVWDQGPXVWEHPHW
xCondition A:
x9DDDQG9DD4DUHGULYHQIURPDVLQJOHSRZHUVRXUFHDQGDUHUDPSHGZLWKDPD[LPXPGHOWDYROWDJHEHWZHHQWKHPRI'9dP9
6ORSHUHYHUVDORIDQ\SRZHUVXSSO\VLJQDOLVDOORZHG7KHYROWDJHOHYHOVRQDOOEDOOVRWKHUWKDQ9DD9DD49VVDQG9VV4PXVWEH
OHVVWKDQRUHTXDOWR9DD4DQG9DDRQRQHVLGHDQGPXVWEHJUHDWHUWKDQRUHTXDOWR9VV4DQG9VVRQWKHRWKHUVLGH
x%RWK9DDDQG9DD4SRZHUVXSSOLHVUDPSWR9DD0,1DQG9DD40,1ZLWKLQt9DD35 PV
x%RWK9DDDQG9DD4SRZHUVXSSOLHVUDPSWR9DD0,1DQG9DD40,1ZLWKLQt9DD35 PV
x95()'4WUDFNV9DD[95()&$WUDFNV9DD x 0.5.
x9TTLVOLPLWHGWR9ZKHQWKHSRZHUUDPSLVFRPSOHWHDQGLVQRWDSSOLHGGLUHFWO\WRWKHGHYLFHKRZHYHUt97'VKRXOGEH
JUHDWHUWKDQRUHTXDOWR]HURWRDYRLGGHYLFHODWFKXS
x&RQGLWLRQ%
x9DDPD\EHDSSOLHGEHIRUHRUDWWKHVDPHWLPHDV9DDQ.
x9DD4PD\EHDSSOLHGEHIRUHRUDWWKHVDPHWLPHDV9TT95()'4DQG95()&$.
x1RVORSHUHYHUVDOVDUHDOORZHGLQWKHSRZHUVXSSO\UDPSIRUWKLVFRQGLWLRQ
2.
8QWLOVWDEOHSRZHUPDLQWDLQ5(6(7?/2:WRHQVXUHWKHRXWSXWVUHPDLQGLVDEOHG+,*+=$IWHUWKHSRZHULVVWDEOH5(6(7?PXVWEH
/2:IRUDWOHDVW˜VWREHJLQWKHLQLWLDOL]DWLRQSURFHVV2'7ZLOOUHPDLQLQWKH+,*+=VWDWHZKLOH5(6(7?LV/2:DQGXQWLO&.(LV
UHJLVWHUHG+,*+
3.
&.(PXVWEH/2:QVSULRUWR5(6(7?WUDQVLWLRQLQJ+,*+
$IWHU5(6(7?WUDQVLWLRQV+,*+ZDLW˜VPLQXVRQHFORFNZLWK&.(/2:
5.
$IWHUWKLV&.(/2:WLPH&.(PD\EHEURXJKW+,*+V\QFKURQRXVO\DQGRQO\123RU'(6FRPPDQGVPD\EHLVVXHG7KHFORFNPXVWEH
SUHVHQWDQGYDOLGIRUDWOHDVWQVDQGDPLQLPXPRIILYHFORFNVDQG2'7PXVWEHGULYHQ/2:DWOHDVWW,6SULRUWR&.(EHLQJUHJLVWHUHG
+,*+:KHQ&.(LVUHJLVWHUHG+,*+LWPXVWEHFRQWLQXRXVO\UHJLVWHUHG+,*+XQWLOWKHIXOOLQLWLDOL]DWLRQSURFHVVLVFRPSOHWH
6.
$IWHU&.(LVUHJLVWHUHG+,*+DQGDIWHUt;35KDVEHHQVDWLVILHG056FRPPDQGVPD\EHLVVXHG,VVXHDQ056/2$'02'(FRPPDQG
WR05ZLWKWKHDSSOLFDEOHVHWWLQJVSURYLGH/2:WR%$DQG%$DQG+,*+WR%$
,VVXHDQ056FRPPDQGWR05ZLWKWKHDSSOLFDEOHVHWWLQJV
8.
,VVXHDQ056FRPPDQGWR05ZLWKWKHDSSOLFDEOHVHWWLQJVLQFOXGLQJHQDEOLQJWKH'//DQGFRQILJXULQJ2'7
9.
,VVXHDQG056FRPPDQGWR05ZLWKWKHDSSOLFDEOHVHWWLQJVLQFOXGLQJD'//5(6(7FRPPDQG t'//.F\FOHVRIFORFNLQSXWDUH
UHTXLUHGWRORFNWKH'//
10.
,VVXHD=4&/FRPPDQGWRFDOLEUDWH5TTDQG521YDOXHVIRUWKHSURFHVVYROWDJHWHPSHUDWXUH3973ULRUWR1250$/RSHUDWLRQt=4,1,7
PXVWEHVDWLVILHG
11.
:KHQtDLLK and t=4,1,7KDYHEHHQVDWLVILHGWKH''56'5$0ZLOOEHUHDG\IRUQRUPDORSHUDWLRQ
LOGIC Devices Incorporated
www.logicdevices.com
85
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 41- INITIALIZATION SEQUENCE
T (MAX) = 200ms
VDD
VDDQ
VTT
See power-up
c onditions
in the
initialization
sequence text,
set up 1
VREF
Power-up
ramp
t VTD
Sta ble and
vali d clo ck
T0
T1
t CK
Tc0
Tb0
Ta0
Td0
CK#
CK
t CKSRX
t CL
t CL
t IOz = 20ns
RESET#
t IS
T (MIN) = 10ns
Valid
CKE
Valid
ODT
t IS
Command
NOP
MRS
MRS
MRS
MRS
ZQCL
Add ress
Code
Code
Code
Code
A10
Code
Code
Code
Code
BA0 = L
BA1 = H
BA2 = L
BA0 = H
BA1 = H
BA2 = L
BA0 = H
BA1 = L
BA2 = L
BA0 = L
BA1 = L
BA2 = L
Valid
DM
BA[2:0]
Valid
Valid
A10 = H
Valid
DQS
DQ
RTT
T = 200μs (MIN)
T = 500μs (MIN)
MR2
All voltage
supplies valid
and stable
t MRD
t MRD
t MRD
t XPR
MR3
MR1 with
DLL ena ble
t MOD
MR0 with
DLL reset
t ZQ INIT
ZQ cali bration
t DLLK
DRAM ready for
external commands
Normal
operation
Indicates a Break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
86
Don ’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MODE REGISTERS
0RGHUHJLVWHUV0505DUHXVHGWRGHILQHYDULRXVPRGHVRISURJUDPPDEOHRSHUDWLRQRIWKH''56'5$0L02'$PRGHUHJLVWHULVSURJUDPPHGYLD
WKH02'(5(*,67(56(7056FRPPDQGGXULQJLQLWLDOL]DWLRQDQGLWUHWDLQVWKHVWRUHGLQIRUPDWLRQH[FHSWIRU05>@ZKLFKLVVHOIFOHDULQJXQWLOLWLVHLWKHU
UHSURJUDPPHG5(6(7?JRHV/2:RUXQWLOWKHGHYLFHORVHVSRZHU
&RQWHQWVRIDPRGHUHJLVWHUFDQEHDOWHUHGE\UHH[HFXWLQJWKH056FRPPDQG,IWKHXVHUFKRRVHVWRPRGLI\RQO\DVXEVHWRIWKHPRGHUHJLVWHUuVYDULDEOHV
DOOYDULDEOHVPXVWEHSURJUDPPHGZKHQWKH056FRPPDQGLVLVVXHG5HSURJUDPPLQJWKHPRGHUHJLVWHUZLOOQRWDOWHUWKHFRQWHQWVRIWKHPHPRU\DUUD\
SURYLGHGLWLVSHUIRUPHGFRUUHFWO\
7KH056FRPPDQGFDQRQO\EHLVVXHGRUUHLVVXHGZKHQDOOEDQNVDUHLGOHDQGLQWKH35(&+$5*('VWDWHt53LVVDWLVILHGDQGQRGDWDEXUVWVDUHLQSURJUHVV$IWHUDQ056FRPPDQGKDVEHHQLVVXHGWZRSDUDPHWHUVPXVWEHVDWLVILHGtMRD and tMOD.
7KHFRQWUROOHUPXVWZDLWt05'EHIRUHLQLWLDWLQJDQ\VXEVHTXHQW056FRPPDQGVVHH)LJXUH
FIGURE 42- MRS-TO-MRS COMMAND TIMING (tMRD)
T0
T1
T2
Ta0
Ta1
Ta2
MRS1
NOP
NOP
NOP
NOP
MRS2
CK#
CK
Command
t MRD
Add ress
Valid
Valid
CKE 3
Indicates a Break in
Time Scale
Don ’t Care
127(6
1.
3ULRUWRLVVXLQJWKH056FRPPDQGDOOEDQNVPXVWEHLGOHDQGSUHFKDUJHGt530,1PXVWEHVDWLVILHG
DQGQRGDWDEXUVWVFDQEHLQSURJUHVVWKHOHYHOLQJSURFHGXUH
2.
t05'VSHFLILHVWKH056WR056FRPPDQGPLQLPXPF\FOHWLPH
3.
&.( PXVW EH UHJLVWHUHG +,*+ IURP WKH 056 FRPPDQG XQWLO t0563'(1 0,1 VHH v3RZHU'RZQ
0RGHwRQSDJH
)RUD&$6ODWHQF\FKDQJHt;3'//WLPLQJPXVWEHPHWEHIRUHDQ\QRQ056FRPPDQG
7KHFRQWUROOHUPXVWDOVRZDLW t02'EHIRUHLQLWLDWLQJDQ\QRQ056FRPPDQGVH[FOXGLQJ123DQG'(6DVVKRZQLQ)LJXUHRQSDJH7KH'5$0
UHTXLUHVt02'LQRUGHUWRXSGDWHWKHUHTXHVWHGIHDWXUHVZLWKWKHH[FHSWLRQRI'//5(6(7ZKLFKUHTXLUHVDGGLWLRQDOWLPH8QWLOt02'KDVEHHQVDWLVILHGWKH
XSGDWHGIHDWXUHVDUHWREHDVVXPHGXQDYDLODEOH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 43- MRS-TO-NONMRS COMMAND TIMING (tMOD)
T1
T2
t WLS
t WLH
CK#
CK
Command
MRS1
NOP2
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
t MOD
ODT
t WLDQSEN
t DQSL3
t DQSH3
t DQSL3
t DQSH3
Differential DQS4
t WLMRD
t WLO
t WLO
Prime DQ 5
t WLO
t WLOE
Early remaining DQ
t WLO
Late remaining DQ
Indicates a Break in
Time Scale
Undefined Driving Mode
Don’t Care
127(6
1.
3ULRUWRLVVXLQJWKH056FRPPDQGDOOEDQNVPXVWEHLGOHWKH\PXVWEHSUHFKDUJHGt53PXVWEH
VDWLVILHGDQGQRGDWDEXUVWVFDQEHLQSURJUHVV
2.
3.
3ULRUWR7DZKHQt02'0,1LVEHLQJVDWLVILHGQRFRPPDQGVH[FHSW123'(6PD\EHLVVXHG
,I577ZDVSUHYLRXVO\HQDEOHG2'7PXVWEHUHJLVWHUHG/2:DW7VRWKDW2'7/LVVDWLVILHGSULRU
WR7D2'7PXVWDOVREHUHJLVWHUHG/2:DWHDFKULVLQJ&.HGJHIURP7XQWLO t02'0,1LV
VDWLVILHGDW7D
&.( PXVW EH UHJLVWHUHG +,*+ IURP WKH 056 FRPPDQG XQWLO t0563'(1 0,1 DW ZKLFK WLPH
SRZHUGRZQPD\RFFXUVHHv3RZHU'RZQ0RGHwRQSDJH
MODE REGISTER 0 (MR0)
7KHEDVHUHJLVWHU05LVXVHGWRGHILQHYDULRXV''5L02'PRGHVRIRSHUDWLRQ7KHVHGHILQLWLRQVLQFOXGHWKHVHOHFWLRQRIDEXUVWOHQJWKEXUVWW\SH&$6
ODWHQF\RSHUDWLQJPRGH'//5(6(7:5,7(UHFRYHU\DQG35(&+$5*(SRZHUGRZQPRGHDVVKRZQLQ)LJXUH
LOGIC Devices Incorporated
www.logicdevices.com
88
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MODE REGISTER 0 (MR0)
BURST TYPE
BURST LENGTH
$FFHVVHVZLWKLQDJLYHQEXUVWPD\EHSURJUDPPHGWRHLWKHUDVHTXHQWLDO
RUDQLQWHUOHDYHGRUGHU7KHEXUVWW\SHLVVHOHFWHGYLD05>@DVVKRZQ
LQ)LJXUH7KHRUGHULQJRIDFFHVVHVZLWKLQDEXUVWLVGHWHUPLQHGE\WKH
EXUVW OHQJWK WKH EXUVW W\SH DQG WKH VWDUWLQJ FROXPQ DGGUHVV DV VKRZQ
LQ7DEOH''5RQO\VXSSRUWVELWEXUVWFKRSDQGELWEXUVWDFFHVV
PRGHV )XOO LQWHUOHDYHGDGGUHVV RUGHULQJ LVVXSSRUWHG IRU5($'VZKLOH
:5,7(VDUHUHVWULFWHGWRQLEEOH%&RUZRUG%/ERXQGDULHV
%XUVW OHQJWK LV GHILQHG E\ 05>@ VHH )LJXUH 5($' DQG :5,7(
DFFHVVHV WR WKH ''5 6'5$0 L02' DUH EXUVWRULHQWHG ZLWK WKH EXUVW
OHQJWKEHLQJSURJUDPPDEOHWRvwFKRSPRGHvwIL[HGEXUVWRUVHOHFWDEOH XVLQJ $ GXULQJ D 5($':5,7( FRPPDQG RQ WKH IO\ 7KH EXUVW
OHQJWK GHWHUPLQHV WKH PD[LPXP QXPEHU RI FROXPQ ORFDWLRQV WKDW FDQ EH
DFFHVVHGIRUDJLYHQ5($'RU:5,7(FRPPDQG:KHQ05>@LVVHWWR
vwGXULQJD5($':5,7(FRPPDQGLI$ WKHQ%&FKRSPRGHLV
VHOHFWHG,I$ WKHQ%/PRGHLVVHOHFWHG6SHFLILFWLPLQJGLDJUDPV
DQG WXUQDURXQG EHWZHHQ 5($':5,7( DUH VKRZQ LQ WKH 5($':5,7(
VHFWLRQVRIWKLVGRFXPHQW
:KHQ D 5($' RU :5,7( FRPPDQG LV LVVXHG D EORFN RI FROXPQV HTXDO
WRWKHEXUVWOHQJWKLVHIIHFWLYHO\VHOHFWHG$OODFFHVVHVIRUWKDWEXUVWWDNH
SODFHZLWKLQWKLVEORFNPHDQLQJWKDWWKHEXUVWZLOOZUDSZLWKLQWKHEORFNLI
DERXQGDU\LVUHDFKHG7KHEORFNLVXQLTXHO\VHOHFWHGE\$>[email protected]
EXUVW OHQJWK LV VHW WR vw DQG E\ $>[email protected] ZKHQ WKH EXUVW OHQJWK LV VHW WR vw
ZKHUH$LLVWKHPRVWVLJQLILFDQWFROXPQDGGUHVVELWIRUDJLYHQVWDUWLQJORFDWLRQZLWKLQWKHEORFN7KHSURJUDPPHGEXUVWOHQJWKDSSOLHVWRERWK5($'
DQG:5,7(EXUVWV
FIGURE 44- MODE REGISTER 0 (MR0) DEFINITIONS
BA2 BA 1 BA 0 A13 A12 A11 A10 A9 A8 A7 A6 A5 A4 A3 A2 A1 A0
Address bus
16 15 14 13 12 11 10
0 0 01 PD
WR
Mode register 0 (MR0)
9
01
M15 M14
8 7 6 5 4 3 2
DLL 01 CAS# latency BT 01
1 0
BL
M1 M0
Mode Register
0
0
0
1
Burst Length
Fixed BL8
0
0
Mode register 0 (MR0)
0
1
Mode register 1 (MR1)
M12
Precharge PD
1
0
Mode register 2 (MR2)
0
DLL off (slow exit)
0
No
1
0
Fixed BC4 (chop)
1
1
Mode register 3 (MR3)
1
DLL on (fast exit)
1
Yes
1
1
Reserved
LOGIC Devices Incorporated
Write Recovery
M6 M5 M4
4 or 8 (on-the-fly via A12)
CAS Latency
M3
READ Burst Type
0
0
0
Reserved
0
0
0
Reserved
0
Sequential (nibble)
0
0
1
5
0
0
1
5
1
Interleaved
0
1
0
6
0
1
0
6
0
1
1
7
0
1
1
7
1
0
0
8
1
0
0
8
1
0
1
10
1
0
1
9
1
1
0
12
1
1
0
10
1
1
1
Reserved
1
1
1
11
M11 M10 M9
Notes:
M8 DLL Reset
1. MR0[16, 13, 7, 2] are reserved for future use and must be programmed to “0.”
www.logicdevices.com
89
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 60: BURST ORDER
Burst Length
Read/Write
&+23
Starting Column
Address (A[2,1,0])
5($'
:5,7(
8
5($'
:5,7(
000
001
Burst Type (Decimal)
Type = Sequential
Type = Interleaved
====
1,2
====
====
1,2
010
====
====
1,2
011
====
====
1,2
100
====
====
1,2
101
====
====
1,2
110
====
====
1,2
111
====
====
1,2
99
;;;;
;;;;
99
;;;;
;;;;
000
1
001
1
010
1
011
1
100
1
101
1
110
1
111
1
1,3
999
127(6
1.
,QWHUQDO5($'DQG:5,7(RSHUDWLRQVVWDUWDWWKHVDPHSRLQWLQWLPHIRU
%&DVWKH\GRIRU%/
DLL RESET
2.
= 'DWDDQG6WUREHRXWSXWGULYHUVLQWULVWDWH
3.
; w'RQuW&DUHw
WRITE RECOVERY
'//5(6(7LVGHILQHGE\05>@VHH)LJXUH3URJUDPPLQJ05>@
WRvwDFWLYDWHVWKH'//5(6(7IXQFWLRQ05>@LVVHOIFOHDULQJPHDQLQJ LW UHWXUQV WR D YDOXH RI vw DIWHU WKH '// 5(6(7 IXQFWLRQ KDV EHHQ
initiated.
:5,7(5(&29(5<WLPHLVGHILQHGE\05>@VHH)LJXUH:5,7(
5(&29(5< YDOXHV RI RU PD\ EH XVHG E\ SURJUDPPLQJ
05>@7KHXVHULVUHTXLUHGWRSURJUDPWKHFRUUHFWYDOXHRI:5,7(
5(&29(5<DQGLVFDOFXODWHGE\GLYLGLQJt:5QVE\t&.QVDQGURXQGLQJ XS D QRQLQWHJHU YDOXH WR WKH QH[W LQWHJHU :5 F\FOHV URXQGXS
t:5>[email protected]&.>[email protected]
$Q\WLPHWKH'//5(6(7IXQFWLRQKDVEHHQLQLWLDWHG&.(PXVWEH+,*+
DQG WKH FORFN KHOG VWDEOH IRU t'//. FORFN F\FOHV EHIRUH D 5($'
FRPPDQGFDQEHLVVXHG7KLVLVWRDOORZWLPHIRUWKHLQWHUQDOFORFNWREH
V\QFKURQL]HGZLWKWKHH[WHUQDOFORFN)DLOLQJWRZDLWIRUV\QFKURQL]DWLRQ
WRRFFXUPD\UHVXOWLQLQYDOLGRXWSXWWLPLQJVSHFLILFDWLRQVVXFKDVt'46&.
WLPLQJV
LOGIC Devices Incorporated
Notes
====
www.logicdevices.com
90
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
CAS Latency (CL)
PRECHARGE POWER-DOWN (PRECHARGE PD)
7KH35(&+$5*(3'ELWDSSOLHVRQO\ZKHQ35(&+$5*(SRZHUGRZQ
PRGHLVEHLQJXVHG:KHQ05>@LVVHWWRvwWKH'//LVRIIGXULQJ
35(&+$5*(SRZHUGRZQSURYLGLQJDORZHUVWDQGE\FXUUHQWPRGHKRZHYHU t;3'// PXVW EH VDWLVILHG ZKHQ H[LWLQJ :KHQ 05>@ LV VHW WR
vwWKH'//FRQWLQXHVWRUXQGXULQJ35(&+$5*(SRZHUGRZQPRGHWR
HQDEOH D IDVWHU H[LW RI 35(&+$5*( SRZHUGRZQ PRGH KRZHYHU t;3
PXVWEHVDWLVILHGZKHQH[LWLQJVHH3RZHU'RZQPRGHRQ3DJH
7KH&/LVGHILQHGE\05>@DVVKRZQLQ)LJXUH&$6ODWHQF\LVWKH
GHOD\DVPHDVXUHGLQFORFNF\FOHVEHWZHHQWKHLQWHUQDO5($'FRPPDQG
DQGWKHDYDLODELOLW\RIWKHILUVWELWRIYDOLGRXWSXWGDWD7KH&/FDQEHVHW
WRRU''56'5$0L02'VGRQRWVXSSRUWKDOIFORFNODWHQFLHV
([DPSOHVRI&/ DQG&/ DUHVKRZQLQ)LJXUHEHORZ,IDQLQWHUQDO
5($'FRPPDQGLVUHJLVWHUHGDWFORFNHGJHQDQGWKH&$6ODWHQF\LVP
FORFNVWKHGDWDZLOOEHDYDLODEOHQRPLQDOO\FRLQFLGHQWZLWKFORFNHGJHQP
7DEOHLQGLFDWHVWKH&/VVXSSRUWHGDWDYDLODEOHRSHUDWLQJIUHTXHQFLHV
FIGURE 45- READ LATENCY
T0
T1
T2
T3
T4
T5
T6
T7
T8
READ
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
AL = 0, CL = 6
DQS, DQS#
DI
n
DQ
DI
n+1
DI
n+2
DI
n+3
DI
n+4
T0
T1
T2
T3
T4
T5
T6
T7
T8
READ
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
AL = 0, CL = 8
DQS, DQS#
DI
n
DQ
Transitioning Data
Don’t Care
127(6
1.
)RULOOXVWUDWLRQSXUSRVHVRQO\&/ DQG&/ DUHVKRZQ2WKHU&/YDOXHVDUH
SRVVLEOH
2.
LOGIC Devices Incorporated
6KRZQZLWKQRPLQDOt'46&.DQGQRPLQDOtDSDQ.
www.logicdevices.com
91
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MODE REGISTER 1 (MR1)
7KH 02'( 5(*,67(5 05 FRQWUROV DGGLWLRQDO IXQFWLRQV DQG IHDWXUHV QRW DYDLODEOH LQ WKH RWKHU PRGH UHJLVWHUV 4 2)) 287387 ',6$%/( '//
(1$%/('//',6$%/(5TTB120YDOXH2'7:5,7(/(9(/,1*3267('&$6$'',7,9(ODWHQF\DQG287387'5,9(675(1*7+7KHVHIXQFWLRQV
DUHFRQWUROOHGYLDWKHELWVVKRZQLQ)LJXUHEHORZ7KH05UHJLVWHULVSURJUDPPHGYLDWKH05FRPPDQGDQGUHWDLQVWKHVWRUHGLQIRUPDWLRQXQWLOLWLV
UHSURJUDPPHGXQWLO5(6(7?JRHV/2:WUXHRUXQWLOWKHGHYLFHORVHVSRZHU5HSURJUDPPLQJWKH05UHJLVWHUZLOOQRWDOWHUWKHFRQWHQWVRIWKHPHPRU\
DUUD\SURYLGHGWKHRSHUDWLRQLVSHUIRUPHGFRUUHFWO\
7KH05UHJLVWHUPXVWEHORDGHGZKHQDOOEDQNVDUHLGOHDQGQREXUVWVDUHLQSURJUHVV7KHFRQWUROOHUPXVWVDWLVI\WKHVSHFLILHGWLPLQJSDUDPHWHUVtMRD and
t02'EHIRUHLQLWLDWLQJDVXEVHTXHQWRSHUDWLRQ
FIGURE 46- MODE REGISTER 1 (MR1) DEFINITION
BA2 BA 1 BA 0 A13 A12 A11 A10 A9 A 8 A7 A6 A5 A4 A3 A 2
A1 A0
Address bus
16 15 14 13 12 11 10 9 8 7 6 5
01 0 1 01 Q Off TDQS 01 RTT 01 WL RTT ODS
M15 M14
4 3 2
1 0
AL RTT ODS DLL
Mode register 1 (MR1)
Mode Register
0
0
Mode register set 0 (MR0)
M12
Q Off
M11
TDQS
0
1
Mode register set 1 (MR1)
0
Enabled
0
Disabled
1
0
Mode register set 2 (MR2)
1
Disabled
1
Enabled
1
1
Mode register set 3 (MR3)
RTT_NOM (ODT)2
M0
DLL Enable
0
Enable (normal)
1
Disable
M5 M1 Output Drive Strength
RTT_NOM (ODT)3
M7 Write Levelization
M9 M6 M2
Non-Writes
Writes
0
Disable (normal)
0 0 0
RTT_NOM disabled
RTT_NOM disabled
1
Enable
0 0 1
RZQ/4 (60Ω [NOM])
RZQ/4 (60Ω [NOM])
0
0
RZQ/6 (40Ω [NOM])
0
1
RZQ/7 (34Ω [NOM])
1
0
Reserved
1
1
Reserved
0 1 0 RZQ/2 (120Ω [NOM]) RZQ/2 (120Ω [NOM])
0 1 1
RZQ/6 (40Ω [NOM])
RZQ/6 (40Ω [NOM])
M4 M3 Additive Latency (AL)
1 0 0 RZQ/12 (20Ω [NOM])
n/a
0
0
Disabled (AL = 0)
1 0 1
RZQ/8 (30Ω [NOM])
n/a
0
1
AL = CL - 1
1 1 0
Reserved
Reserved
1
0
AL = CL - 2
1 1 1
Reserved
Reserved
1
1
Reserved
127(6
1.
2.
05>@DUHUHVHUYHGIRUIXWXUHXVHDQGPXVWEHSURJUDPPHGWRvw
'XULQJZULWHOHYHOLQJLI05>@DQG05>@DUHvwWKHQDOO5TTB120YDOXHVDUHDYDLODEOH
IRUXVH
3.
'XULQJZULWHOHYHOLQJLI05>@LVDvwEXW05>@LVDvwWKHQRQO\5TTB120ZULWHYDOXHV
DUHDYDLODEOHIRUXVH
LOGIC Devices Incorporated
www.logicdevices.com
92
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ON-DIE TERMINATION (ODT)
DLL ENABLE/DLL DISABLE
7KH'//PD\EHHQDEOHGRUGLVDEOHGE\SURJUDPPLQJ05>@GXULQJWKH
/2$' 02'( FRPPDQG DV VKRZQ LQ )LJXUH SUHYLRXV SDJH 7KH
'//PXVWEHHQDEOHGIRU1250$/RSHUDWLRQ'//(1$%/(LVUHTXLUHG
GXULQJSRZHUXSLQLWLDOL]DWLRQDQGXSRQUHWXUQLQJWR1250$/RSHUDWLRQ
DIWHUKDYLQJ',6$%/('WKH'//IRUWKHSXUSRVHRIGHEXJJLQJRUHYDOXDWLRQ(1$%/,1*WKH'//VKRXOGDOZD\VEHIROORZHGE\UHVHWWLQJWKH'//
XVLQJWKHDSSURSULDWH/2$'02'(FRPPDQG
2'7UHVLVWDQFH5TTB120LVGHILQHGE\05>@VHH)LJXUH7KH
RTT WHUPLQDWLRQ YDOXH DSSOLHV WR WKH '4[ /'0[ 8'0[ />[email protected]'46[ DQG
/>[email protected]'46[?7KH''5GHYLFHDUFKLWHFWXUHVXSSRUWVPXOWLSOH5TTWHUPLQDWLRQYDOXHVEDVHGRQ5=4QZKHUHQFDQEHRUDQG5=4LV:.
8QOLNH''5''52'7PXVWEHWXUQHGRIISULRUWR5($',1*GDWDRXW
DQGPXVWUHPDLQRIIGXULQJ5($'EXUVW5TTB120WHUPLQDWLRQLVDOORZHG
DQ\WLPHDIWHUWKH'5$0LVLQLWLDOL]HGFDOLEUDWHGDQGQRWSHUIRUPLQJ5($'
DFFHVVHV RU LQ 6(/) 5()5(6+ PRGH $GGLWLRQDOO\ :5,7( DFFHVVHV
ZLWKG\QDPLF2'7HQDEOHG5TTB:5WHPSRUDULO\UHSODFHV5TTB120ZLWK
RTTB:5
,IWKH'//LVHQDEOHGSULRUWRHQWHULQJ6(/)5()5(6+PRGHWKH'//LV
DXWRPDWLFDOO\',6$%/('ZKHQHQWHULQJ6(/)5()5(6+RSHUDWLRQDQG
LVDXWRPDWLFDOO\5((1$%/('DQG5(6(7XSRQH[LWRI6(/)5()5(6+
,I WKH '// LV ',6$%/(' SULRU WR HQWHULQJ 6(/) 5()5(6+ WKH '//
UHPDLQV',6$%/('HYHQXSRQH[LWRIWKH6(/)5()5(6+RSHUDWLRQXQWLO
LWKDVEHHQ5((1$%/('DQG5(6(7
7KHDFWXDOHIIHFWLYHWHUPLQDWLRQ5TTB())PD\EHGLIIHUHQWIURPWKH5TT
WDUJHWHGYDOXHGXHWRQRQOLQHDULW\RIWKHWHUPLQDWLRQ)RU5TTB())YDOXHV
DQGFDOFXODWLRQVVHHWKH21',(7(50,1$7,212'7GHVFULSWLRQODWHU
LQWKLV'6
7KH6'5$0LVQRWWHVWHGQRUGRHV/',ZDUUDQWFRPSOLDQFHZLWK1250$/
PRGHWLPLQJVRUIXQFWLRQDOLW\ZKHQWKH'//LVGLVDEOHG$QDWWHPSWKDV
EHHQPDGHIRUWKH6'5$0WRRSHUDWHLQWKH1250$/PRGHZKHQHYHU
SRVVLEOHZKHQWKH'//LVGLVDEOHGKRZHYHUE\LQGXVWU\VWDQGDUGVWKH
IROORZLQJH[FHSWLRQVKDYHEHHQREVHUYHGGHILQHGDQGOLVWHG
7KH 2'7 IHDWXUH LV GHVLJQHG WR LPSURYH VLJQDO LQWHJULW\ RI WKH PHPRU\
GHYLFHE\HQDEOLQJWKH''56'5$0FRQWUROOHUWRLQGHSHQGHQWO\WXUQ21
2))2'7IRUDQ\RUDOOGHYLFHVLQWKHHQGGHVLJQVDUUD\7KH2'7LQSXW
FRQWUROSLQLVXVHGWRGHWHUPLQHZKHQ5TT LVWXUQHGRQ2'7/RQDQGRII
2'7/RIIDVVXPLQJ2'7KDVEHHQ(1$%/('YLD05>@
1. 2'7LV127$//2:('WREHXVHG
2. 7KH287387'$7$LVQRORQJHUHGJHDOLJQHGWRWKHFORFN
3. &/DQG&:/FDQRQO\EHVL[FORFNV
7LPLQJVIRU2'7DUHGHWDLOHGLQWKHv21',(7HUPLQDWLRQ2'7wGHVFULSWLRQODWHULQWKLV'6
:KHQWKH'//LV',6$%/('WLPLQJDQGIXQFWLRQDOLW\FDQYDU\IURPWKH
1250$/ RSHUDWLRQDO VSHFLILFDWLRQV ZKHQ WKH '// LV HQDEOHG ',6$%/,1*WKH'//DOVRLPSOLHVWKHQHHGWRFKDQJHWKHFORFNIUHTXHQF\
WRITE LEVELING
OUTPUT DRIVE STRENGTH
7KH:5,7(/(9(/,1*IXQFWLRQLVHQDEOHGE\05>@DVVKRZQLQ)LJXUH
:5,7(/(9(/,1*LVXVHGGXULQJLQLWLDOL]DWLRQWRGHVNHZWKH'46[
VWUREH WR FORFN RIIVHW DV D UHVXOW RI IO\E\ WRSRORJ\ GHVLJQV )RU EHWWHU
VLJQDO LQWHJULW\ VRPH HQG XVH GHVLJQV RI ''5 GHYLFHV DGRSWHG IO\E\
WRSRORJ\IRUWKHFRPPDQGVDGGUHVVHVFRQWUROVLJQDOVDQGFORFNV
7KH ''5 6'5$0 L02' XVHV D SURJUDPPDEOH LPSHGDQFH RXWSXW
EXIIHU7KHGULYHVWUHQJWKPRGHUHJLVWHUVHWWLQJLVGHILQHGE\05>@
5=4:>[email protected]\RXWSXWGULYHULPSHGDQFHVHWWLQJIRUWKH
GHYLFH7RFDOLEUDWHWKHRXWSXWGULYHULPSHGDQFHDQGH[WHUQDOSUHFLVLRQ
UHVLVWRU5=4LVFRQQHFWHGEHWZHHQWKH=4EDOODQG9VV47KHYDOXHRI
WKHUHVLVWRULV:”
7KH IO\E\ WRSRORJ\ EHQHILWV IURP D UHGXFHG QXPEHU RI VWXEV DQG WKHLU
OHQJWKV KRZHYHU IO\E\ WRSRORJ\ LQGXFHV IOLJKW WLPH VNHZ EHWZHHQ WKH
FORFNDQG'46[VWUREHDQG'4[DWHDFK6'5$0LQWKHDUUD\&RQWUROOHUVZLOOKDYHDGLIILFXOWWLPHPDLQWDLQLQJtDQSS, tDSS and t'6+VSHFLILFDWLRQVZLWKRXWVXSSRUWLQJ:5,7(/(9(/,1*LQV\VWHPVZKLFKXVHIO\E\
WRSRORJ\EDVHGGHVLJQV:5,7(/(9(/,1*WLPLQJDQGGHWDLOHGRSHUDWLRQ
LQIRUPDWLRQLVSURYLGHGLQv:5,7(/(9(/,1*
7KHRXWSXWLPSHGDQFHLVVHWGXULQJLQLWLDOL]DWLRQ$GGLWLRQDOLPSHGDQFH
FDOLEUDWLRQXSGDWHVGRQRWDIIHFWGHYLFHRSHUDWLRQDQGDOOGDWDVKHHWWLPLQJVDQGFXUUHQWVSHFLILFDWLRQVDUHPHWGXULQJDQXSGDWH
7RPHHWWKH:VSHFLILFDWLRQWKHRXWSXWGULYHVWUHQJWKPXVWEHVHWWR
:GXULQJLQLWLDOL]DWLRQ7RREWDLQDFDOLEUDWHGRXWSXWGULYHULPSHGDQFH
DIWHUSRZHUXSWKH''5L02'6'5$0QHHGVDFDOLEUDWLRQFRPPDQG
WKDWLVSDUWRIWKHLQLWLDOL]DWLRQDQGUHVHWSURFHGXUH
OUTPUT ENABLE/DISABLE
7KH 287387 (1$%/( IXQFWLRQ LV GHILQHG E\ 05>@ DV VKRZQ LQ
)LJXUH:KHQHQDEOHG05>@ DOORXWSXWV'4['46['46[?
DUHWULVWDWHG7KHRXWSXW',6$%/(IHDWXUHLVLQWHQGHGWREHXVHGGXULQJ
IDD FKDUDFWHUL]DWLRQ RI WKH 5($' FXUUHQW DQG GXULQJ t'466 PDUJLQLQJ
:5,7(/(9(/,1*RQO\
LOGIC Devices Incorporated
www.logicdevices.com
93
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
POSTED CAS ADDITIVE LATENCY (AL)
$/LVVXSSRUWHGWRPDNHWKHFRPPDQGDQGGDWDEXVHIILFLHQWIRUVXVWDLQDEOHEDQGZLGWKVLQ''565$0V05>@GHILQHWKHYDOXHRI$/VHH)LJXUH
05>@HQDEOHVWKHXVHUWRSURJUDPWKH''56'5$0ZLWKDQ$/ &/RU&/
:LWKWKLVIHDWXUHWKH''56'5$0HQDEOHVD5($'RU:5,7(FRPPDQGWREHLVVXHGDIWHUWKH$&7,9$7(FRPPDQGIRUWKDWEDQNSULRUWRt5&'0,17KH
RQO\UHVWULFWLRQLV$&7,9$7(WR5($'RU:5,7($/t t5&'0,1PXVWEHVDWLVILHG$VVXPLQJt5&'0,1 &/DW\SLFDODSSOLFDWLRQXVLQJWKLVIHDWXUHVHWV
$/ &/yt&. t5&'0,1t&.7KH5($'RU:5,7(FRPPDQGLVKHOGIRUWKHWLPHRIWKH$/EHIRUHLWLVUHOHDVHGLQWHUQDOO\WRWKH''56'5$0L02'
GHYLFH5($'ODWHQF\5/LVFRQWUROOHGE\WKHVXPRIWKH$/DQG&$6ODWHQF\&/5/ $/&/:5,7(ODWHQF\:/LVWKHVXPRI&$6:5,7(ODWHQF\DQG
$/:/ $/&:/VHHv02'(5(*,67(505w([DPSOHVRI5($'DQG:5,7(ODWHQFLHVDUHVKRZQLQ)LJXUHDQG)LJXUH
FIGURE 47- READ LATENCY (AL = 5, CL = 6)
BC4
T0
T1
ACTIVE n
READ n
T2
T6
T11
T12
T13
T14
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
t RCD (MIN)
DQS, DQS#
AL = 5
CL = 6
DO
n
DQ
DO
n+1
DO
n+2
DO
n+3
RL = AL + CL = 11
Indicates a Break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
Transitioning Data
Don’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MODE REGISTER 2 (MR2)
7KH02'(5(*,67(505FRQWUROVDGGLWLRQDOIXQFWLRQVDQGIHDWXUHVQRWDYDLODEOHLQWKHRWKHUPRGHUHJLVWHUV7KHVHDGGLWLRQDOIXQFWLRQVDUH&$6
:5,7(ODWHQF\&:/$8726(/)5()5(6+$656(/)5()5(6+7(03(5$785(657DQG'<1$0,&2'75TTB:57KHVHIXQFWLRQVDUHFRQWUROOHGYLDWKHELWVVKRZQLQ)LJXUH7KH05LVSURJUDPPHGYLDWKH056FRPPDQGDQGZLOOUHWDLQWKHVWRUHGLQIRUPDWLRQXQWLOLWLVSURJUDPPHGDJDLQRU
XQWLOWKHGHYLFHORVHVSRZHU5HSURJUDPPLQJWKH05UHJLVWHUZLOOQRWDOWHUWKHFRQWHQWVRIWKHPHPRU\DUUD\SURYLGHGWKDWWKHRSHUDWLRQKDVEHHQSHUIRUPHG
FRUUHFWO\7KH05UHJLVWHUPXVWEHORDGHGZKHQDOOEDQNVDUHLGOHDQGQRGDWDEXUVWVDUHLQSURJUHVVDQGWKHPHPRU\FRQWUROOHUPXVWZDLWIRUWKHVSHFLILHG
WLPHtMRD and t02'EHIRUHLQLWLDWLQJDVXEVHTXHQWRSHUDWLRQ
FIGURE 48- MODE REGISTER 2 (MR2) DEFINITION
BA2 BA 1 BA 0 A13 A12 A11 A10 A9 A8 A7 A 6 A5 A4 A3 A2 A1 A0
Address bus
16 15 14 13 12 11 10 9 8 7 6
0 01 01 01 RTT_WR 01 SRT ASR
Mode Register 2 (MR2)
5
01 1
M15 M14
Mode Register
M5 M4 M3
2 1 0
01 01 01
CAS Write Latency (CWL)
5 CK (t CK ≥ 2.5ns)
0
Mode register set 0 (MR0)
0
Normal (0° C to 85° C)
0
0
0
0
1
Mode register set 1 (MR1)
1
Extended (0°C to 95° C)
0
0
1
1
0
Mode register set 2 (MR2)
0
1
0
6 CK (2.5ns > t CK ≥ 1.875ns)
7 CK (1.875ns > t CK ≥ 1.5ns)
1
1
Mode register set 3 (MR3)
0
1
1
8 CK (1.5ns > t CK ≥ 1.25ns)
1
0
0
Reserved
1
0
1
Reserved
1
1
0
Reserved
1
1
1
Reserved
0
LOGIC Devices Incorporated
3
0
M10 M9
Notes:
M7 Self Refresh Temperature
4
CWL
0
Dynamic ODT
( R TT_WR )
RTT_WR disabled
RZQ/4
0
1
1
0
RZQ/2
1
1
Reserved
M6
0
Auto Self Refresh
(Optional)
Disabled: Manual
1 Enabled: Automatic
1. MR2[16, 13:11, 8, and 2:0] are reserved for future use and must all be programmed to “0.”
www.logicdevices.com
95
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
CAS WRITE LATENCY (CWL)
&:/LVGHILQHGE\05>@DQGLVWKHGHOD\LQFORFNF\FOHVIURPWKHUHOHDVLQJRIWKHLQWHUQDO:5,7(WRWKHODWFKLQJRIWKHILUVWGDWDLQ&:/PXVWEHFRUUHFWO\
VHWWRWKHFRUUHVSRQGLQJRSHUDWLQJFORFNIUHTXHQF\VHH)LJXUH7KHRYHUDOO:5,7(/$7(1&<:/LVHTXDOWR&:/$/VHH)LJXUH
FIGURE 49- CAS WRITE LATENCY
BC4
T0
T1
ACTIVE n
WRITE n
T2
T6
T11
T12
T13
T14
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
t RCD (MIN)
DQS, DQS#
AL = 5
CWL = 6
DI
n
DQ
DI
n+1
DI
n+2
DI
n+3
WL = AL + CWL = 11
Indicates A Break in
Time Scale
Transitioning Data
Don’t Care
RSWLRQDOH[WHQGHGWHPSHUDWXUHUDQJHRI“&ZKLOHLQ6(/)5()5(6+
PRGH7KHVWDQGDUG6(/)5()5(6+FXUUHQWWHVWVSHFLILHVWHVWFRQGLWLRQV
WRQRUPDODPELHQWWHPSHUDWXUH“&RQO\PHDQLQJLI657LVHQDEOHGWKH
VWDQGDUG6(/)5()5(6+FXUUHQWVSHFLILFDWLRQVGRQRWDSSO\
AUTO SELF REFRESH (ASR)
0RGHUHJLVWHU05>@LVXVHGWR',6$%/((1$%/(WKH$65IXQFWLRQ
:KHQ$65LV',6$%/('WKH6(/)5()5(6+PRGHuV5()5(6+UDWH
LVDVVXPHGWREHDWWKHQRUPDO“&OLPLWFRPPRQO\UHIHUUHGWRDVWKH
;5()5(6+UDWH,QWKH',6$%/('PRGH$65UHTXLUHVWKHXVHUWR
HQVXUHWKH6'5$0QHYHUH[FHHGVD7$RI“&ZKLOHLQ6(/)5()5(6+
XQOHVVWKHXVHUHQDEOHVWKH657IHDWXUHOLVWHGEHORZVXSSRUWLQJDQHOHYDWHGWHPSXSWR“&ZKLOHLQ6(/)5()5(6+
SRT vs. ASR
,IWKHQRUPDODPELHQWWHPSHUDWXUHOLPLWRI“&LVQRWH[FHHGHGWKHQQHLWKHU 657 QRU $65 LV UHTXLUHG DQG ERWK FDQ EH ',6$%/(' WKURXJKRXW
RSHUDWLRQ,IWKHH[WHQGHGWHPSHUDWXUHRSWLRQLVXVHGWKHXVHULVUHTXLUHG
WR SURYLGH D ; UHIUHVK UDWH GXULQJ PDQXDO UHIUHVK IRU ([WHQGHG WHPS
GHYLFHVRU;UHIUHVKUDWHIRU0LOWHPSGHYLFHV657DQG$65VKRXOGEH
HQDEOHGIRUDXWRPDWLF5()5(6+VHUYLFHVRQDOOGHYLFHVXVHGLQWHPSHUDWXUHHQYLURQPHQWVd“&
7KH VWDQGDUG 6(/) 5()5(6+ FXUUHQW WHVW VSHFLILHV WHVW FRQGLWLRQV WR
QRUPDODPELHQWWHPSHUDWXUH“&RQO\PHDQLQJLI$65LVHQDEOHGWKH
VWDQGDUG6(/)5()5(6+FXUUHQWVSHFLILFDWLRQGRHVQRWDSSO\VHHWKH
v(;7(1'('7(03(5$785(86$*(wGHVFULSWLRQODWHULQWKLV'6
657IRUFHVWKH6'5$0WRVZLWFKWKHLQWHUQDO6(/)5()5(6+UDWHIURP
;WR;6(/)5()5(6+LVSHUIRUPHGDW;UHJDUGOHVVRIT$.
SELF REFRESH TEMPERATURE (SRT)
$65 DXWRPDWLFDOO\ VZLWFKHV WKH 6'5$0uV LQWHUQDO 6(/) 5()5(6+ UDWH
IURP ; WR ; KRZHYHU ZKLOH LQ 6(/) 5()5(6+ PRGH $65 HQDEOHV
WKH 5()5(6+ UDWH DXWRPDWLFDOO\ DGMXVW EHWZHHQ ; DQG ; 5()5(6+
UDWHRYHUWKHVXSSRUWHGWHPSHUDWXUHUDQJH2QHRWKHUGLVDGYDQWDJHZLWK
$65LVWKH6'5$0FDQQRWDOZD\VVZLWFKIURPD;WRD;UHIUHVKUDWHDW
DQH[DFWDPELHQW7HPSHUDWXUHRI“&$OWKRXJKWKH6'5$0ZLOOVXSSRUW
GDWDLQWHJULW\ZKHQLWVZLWFKHVIURPD;WR;UDWHLWPD\VZLWFKDWDORZHU
WHPSHUDWXUHWKDQ“&
0RGH UHJLVWHU 05>@ LV XVHG WR ',6$%/((1$%/( WKH 657 IXQFWLRQ
:KHQ 657 LV 'LVDEOHG WKH 6(/) 5()5(6+ PRGHuV UHIUHVK UDWH LV
DVVXPHG WR EH DW WKH QRUPDO “& OLPLW ,Q WKH ',6$%/(' PRGH 657
UHTXLUHVWKHXVHUWRHQVXUHWKH6'5$0QHYHUH[FHHGVWKHT$OLPLWRI“&
ZKLOHLQ6(/)5()5(6+PRGHXQOHVVWKHXVHUHQDEOHV$65
:KHQ657LVHQDEOHGWKH6'5$06(/)5()5(6+LVFKDQJHGLQWHUQDOO\
IURP;WR;UHJDUGOHVVRIWKHDPELHQWWHPSHUDWXUH7$7KLVHQDEOHV
WKHXVHUWRRSHUDWHWKH6'5$0EH\RQGWKHVWDQGDUG“&OLPLWXSWRWKH
LOGIC Devices Incorporated
www.logicdevices.com
6LQFHRQO\RQHPRGHLVQHFHVVDU\DWRQHLQVWDQWLQWLPH657DQG$65
FDQQRWEHVLPXOWDQHRXVO\HQDEOHG
96
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
DYNAMIC ODT
7KHG\QDPLF2'75TTB:5IHDWXUHLVGHILQHGE\05>@'\QDPLF2'7LVHQDEOHGZKHQDYDOXHLVVHOHFWHG7KLVQHZ''5IHDWXUHHQDEOHVWKH2'7
WHUPLQDWLRQYDOXHWRFKDQJHZLWKRXWLVVXLQJDQ056FRPPDQGHVVHQWLDOO\FKDQJLQJWKH2'7WHUPLQDWLRQvRQWKHIO\w
:LWK G\QDPLF 2'7 5TTB:5 ZKHQ EHJLQQLQJ D :5,7( EXUVW DQG VXEVHTXHQWO\ VZLWFKHV EDFN WR 2'7 5TTB:5 LV HQDEOHG 2'7/&1: 2'7/&1:
2'7/&1:2'7+2'7+DQGt$'&
'\QDPLF2'7LVRQO\DSSOLFDEOHGXULQJ:5,7(F\FOHV,I2'75TTB120LVGLVDEOHGG\QDPLF2'75TTB:5LVVWLOOSHUPLWWHG5TT_NOM and RTTB:5FDQ
EHXVHGLQGHSHQGHQWRIRQHDQRWKHU'\QDPLF2'7LVQRWDYDLODEOHGXULQJ:5,7(/(9(/,1*PRGHUHJDUGOHVVRIWKHVWDWHRI2'75TTB120)RUGHWDLOV
RQ2'7RSHUDWLRQUHIHUWRWKHv2Q'LH7HUPLQDWLRQ2'7wVHFWLRQ
MODE REGISTER (MR3)
7KHPRGHUHJLVWHU05FRQWUROVDGGLWLRQDOIXQFWLRQVDQGIHDWXUHVQRWDYDLODEOHYLD0505RU05&XUUHQWO\GHILQHGDVWKH08/7,385326(5(*,67(50357KLVIXQFWLRQLVFRQWUROOHGYLDWKHELWVVKRZQLQ)LJXUH7KH05LVSURJUDPPHGYLDWKH/2$'02'(FRPPDQGDQGUHWDLQVWKHVWRUHGLQIRUPDWLRQXQWLOLWLVSURJUDPPHGDJDLQRUXQWLOWKHGHYLFHORVHVSRZHU5HSURJUDPPLQJWKH05UHJLVWHUZLOOQRWDOWHUWKHFRQWHQWVRIWKHPHPRU\DUUD\SURYLGHG
WKHSURJUDPPLQJRIWKH05KDVEHHQSHUIRUPHGFRUUHFWO\7KH05UHJLVWHUPXVWEHORDGHGZKHQDOOEDQNVDUHLGOHDQGQRGDWDEXUVWVDUHLQSURJUHVVDQG
WKHPHPRU\FRQWUROOHUPXVWZDLWWKHVSHFLILHGWLPHtMRD and t02'EHIRUHLQLWLDWLQJDVXEVHTXHQWRSHUDWLRQ
FIGURE 50 - MODE REGISTER 3 (MR3) DEFINITION
BA2 BA 1 BA 0 A13 A12 A11 A10 A9
16
01
A8
A7 A 6 A5
A4 A3
0
MPR Enable
Normal DRAM operations 2
1
Mode register set 1 (MR1)
1
Dataflow from MPR
0
Mode register set 2 (MR2)
1
Mode register set 3 (MR3)
0
0
0
1
1
A1 A0
15 14 13 12 11 10 9
8 7
6
5 4
3
2
1 0
1
1 01 01 01 01 01 01 01 01 01 01 01 MPR MPR_RF
Mo de register set (MR0)
M15 M14
A2
Mode Register
M2
M1 M0
Address bus
Mode register 3 (MR3)
0
0
MPR READ Function
Predefined pattern 3
0
1
Reserved
1
0
Reserved
1
1
Reserved
127(6
LOGIC Devices Incorporated
1.
05>[email protected]
2.
:KHQ035FRQWUROLVVHWIRUQRUPDO'5$0RSHUDWLRQ05>@ZLOOEHLJQRUHG
3.
,QWHQGHGWREHXVHGIRU5($'V\QFKURQL]DWLRQ
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MULTIPURPOSE REGISTER (MPR)
7KH08/7,385326(5(*,67(5IXQFWLRQLVXVHGWRRXWSXWDSUHGHILQHGV\VWHPWLPLQJFDOLEUDWLRQELWVHTXHQFH%LWLVWKHPDVWHUELWWKDWHQDEOHVRUGLVDEOHV
DFFHVVWRWKH035UHJLVWHUDQGELWVDQGGHWHUPLQHZKLFKPRGHWKH035LVSODFHGLQ7KHEDVLFFRQFHSWRIWKHPXOWLSXUSRVHUHJLVWHULVVKRZQLQ)LJXUH
,I05>@LVDvwWKHQWKH035DFFHVVLVGLVDEOHGDQGWKH6'5$0RSHUDWHVLQQRUPDOPRGH+RZHYHULI05>@LVDvwWKHQ6'5$0QRORQJHURXWSXWV
QRUPDOUHDGGDWDEXWRXWSXWV035GDWDDVGHILQHGE\05>@,I05>@LVHTXDOWRvwWKHQDSUHGHILQHGUHDGSDWWHUQIRUV\VWHPFDOLEUDWLRQLVVHOHFWHG
7RHQDEOHWKH035WKH056FRPPDQGLVLVVXHGWR05DQG05>@ VHH7DEOH3ULRUWRLVVXLQJWKH056FRPPDQGDOOEDQNVPXVWEHLQWKHLGOHVWDWH
DOOEDQNVDUHSUHFKDUJHGDQGt53LVPHW:KHQWKH035LVHQDEOHGDQ\VXEVHTXHQW5($'RU5'$3FRPPDQGVDUHUHGLUHFWHGWRWKHPXOWLSXUSRVHUHJLVWHU
7KHUHVXOWLQJRSHUDWLRQZKHQHLWKHUD5($'RUD5'$3FRPPDQGLVLVVXHGLVGHILQHGE\05>@ZKHQ035LVHQDEOHGVHH7DEOH:KHQWKH035LV
HQDEOHGRQO\5($'RU5'$3FRPPDQGVDUHDOORZHGXQWLODVXEVHTXHQW056FRPPDQGLVLVVXHGZLWKWKH035GLVDEOHG05>@ 32:(5'2:16(/)
5()5(6+DQGDQ\RWKHU1215($'RU5'$3FRPPDQGLVQRWDOORZHG7KH5(6(7IXQFWLRQLVVXSSRUWHGGXULQJ035HQDEOHPRGH
FIGURE 51 - MULTIPURPOSE REGISTER (MPR) BLOCK DIAGRAM
Memory core
MR3[2] = 0 (MPR off)
Multipurpose register
pre defined data for READs
MR3[2] = 1 (MPR on)
DQ, DM, DQ S, DQS#
127(6
1.
2.
$SUHGHILQHGGDWDSDWWHUQFDQEHUHDGRXWRIWKH035ZLWKDQH[WHUQDO5($'FRPPDQG
05>@GHILQHVZKHWKHUWKHGDWDIORZFRPHVIURPWKHPHPRU\FRUHRUWKH035:KHQWKHGDWD
IORZ LV GHILQHG WKH 035 FRQWHQWV FDQ EH UHDG RXW FRQWLQXRXVO\ ZLWK D UHJXODU 5($' RU 5'$3
FRPPDQG
LOGIC Devices Incorporated
www.logicdevices.com
98
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 61: BURST ORDER
MR3[2]
MPR
0
MR3[1:0]
MPR READ Function
Function
v'RQuW&DUHw
1RUPDO2SHUDWLRQQR035WUDQVDFWLRQ$OOVXEVHTXHQW5($'VFRPHIURP
WKH6'5$0PHPRU\DUUD\$OOVXEVHTXHQW:5,7(VJRWRWKH6'5$0
PHPRU\DUUD\
1
$>@6HH7DEOH
(QDEOH035PRGHVXEVHTXHQW5($'5'$3FRPPDQGVGHILQHGE\ELWV
and 2.
MPR FUNCTIONAL DESCRIPTION
7KH035-('(&GHILQLWLRQDOORZVIRUHLWKHUDSULPH'4IRUORZHUE\WHDQG'4IRUWKHXSSHUE\WHRIHDFKRIWKHZRUGVFRQWDLQHGLQWKH/',L02'WRRXWSXW
WKH035GDWDZLWKWKHUHPDLQLQJ'4VGULYHQ/2:RUIRUDOO'4VWRRXWSXWWKH035GDWD7KH035UHDGRXWVXSSRUWVIL[HG5($'EXUVWDQG5($'EXUVWFKRS
056DQG27)YLD$%&ZLWKUHJXODU5($'ODWHQFLHVDQG$&WLPLQJVDSSOLFDEOH7KLVSURYLGLQJWKH'//LVORFNHGDVUHTXLUHG
035DGGUHVVLQJIRUDYDOLG0355($'LVDVIROORZV
x$>@PXVWEHVHWWRvwDVWKHEXUVWRUGHULVIL[HGSHUQLEEOH
x$VHOHFWVWKHEXUVWRUGHU
x%/$LVVHWWRvwDQGWKHEXUVWRUGHULVIL[HGWR
x)RUEXUVWFKRSFDVHVWKHEXUVWRUGHULVVZLWFKHGRQWKHQLEEOHEDVHDQG
x$ EXUVWRUGHU x$ EXUVWRUGHU x%XUVWRUGHUELWWKHILUVWELWLVDVVLJQHGWR/6%DQGEXUVWRUGHUELWWKHODVWELWLVDVVLJQHGWR06%
x$>@DUHDv'RQuW&DUHw
x$LVDv'RQuW&DUHw
x$LVDv'RQuW&DUHw
x$6HOHFWVEXUVWFKRSPRGHRQWKHIO\LIHQDEOHGZLWKLQ05
x$LVDv'RQuW&DUHw
x%$>@DUHDv'RQuW&DUHw
LOGIC Devices Incorporated
www.logicdevices.com
99
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MPR REGISTER ADDRESS DEFINITIONS and BURSTING ORDER
7KH035FXUUHQWO\VXSSRUWVDVLQJOHGDWDIRUPDW7KLVGDWDIRUPDWLVDSUHGHILQHG5($'SDWWHUQIRUV\VWHPFDOLEUDWLRQ7KHSUHGHILQHGSDWWHUQLVDOZD\VD
UHSHDWLQJELWSDWWHUQ
([DPSOHVRIWKHGLIIHUHQWW\SHRISUHGHILQHG5($'SDWWHUQEXUVWVDUHVKRZQLQ)LJXUHVDQG
TABLE 62: BURST ORDER
MR3[2]
MR3[1:0]
Function
Burst
Length
00
5($'SUHGHILQHGSDWWHUQIRU
BL8
1
Read
A[2:0]
000
Burst Order and Data Pattern
%XUVW2UGHU
3UHGHILQHGSDWWHUQ
V\VWHPFDOLEUDWLRQ
%&
000
%XUVW2UGHU
3UHGHILQHGSDWWHUQ
%&
100
%XUVW2UGHU
3UHGHILQHGSDWWHUQ
1
1
1
LOGIC Devices Incorporated
01
5)8
10
5)8
11
5)8
www.logicdevices.com
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
100
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
101
DQ
Notes:
0
A [ 15:13]
DQS, DQS#
0
A12/BC#
0
A10/AP
0
00
A[9:3]
A 11
1
A2
1
0
MRS
A[1:0]
t RP
Ta0
3
PREA
T0
Bank add ress
Command
CK#
CK
NOP
NOP
Tc5
NOP
Tc6
t MPRR
MRS
Tc7
0
0
Vali d 1
Val i d
0
0
00
Val i d
Vali d
Vali d
0
NOP
Tc4
02
NOP
Tc3
Vali d
NOP
Tc2
02
RL
NOP
Tc1
3
NOP
Tc0
Vali d
READ1
Tb1
1. READ with BL8 either by MRS or OTF.
2. Memory controller must drive 0 on A[2:0].
t MOD
Tb0
Indicates a Break in
Time Scale
t MOD
NOP
Tc8
NOP
Tc9
Don ’t Care
Valid
Tc10
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 52 - MPR System Read Calibration with BL8: Fixed Burst Order Single Readout
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
102
DQ
Notes:
0
A[15:13]
DQS, DQS#
0
A12/BC#
0
A10/AP
0
00
A[9:3]
A11
1
A2
1
0
MRS
A[1:0]
t RP
Ta
3
PREA
T0
Bank add ress
Command
CK#
CK
RL
NOP
Tc6
NOP
Tc7
t MPRR
NOP
Tc9
Indicates a Break in
Time Scale
NOP
Tc8
0
00
0
Vali d
3
MRS
Tc10
Vali d
RL
Vali d
0
0
NOP
Tc5
Vali d 1
NO
Tc4
Vali d
NOP
Tc3
0
NOP
Tc2
Vali d
Vali d
NOP
Tc1
Vali d
Vali d
Vali d
12
02
Vali d
02
02
READ1
Vali d
t CCD
Vali d
READ1
Tc0
1. READ with BL8 either by MRS or OTF.
2. Memory controller must drive 0 on A[2:0].
t MOD
Tb
Vali d
Don ’t Care
t MOD
Td
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 53 - MPR System Read Calibration with BL8: Fixed Burst Order, Back-to-Back Readout
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
103
DQ
DQS, DQS#
Notes:
1.
2.
3.
4.
Vali d 1
0
0
Vali d 1
Val i d
0
A 11
A12/BC#
A[15:13]
Vali d
Val i d
0
1
RL
Vali d
NOP
Tc1
NOP
Tc2
RL
NOP
Tc3
READ with BC4 either by MRS or OTF.
Memory controller must drive 0 on A[1:0].
A2 = 0 selects lower 4 nibble bits 0 . . . 3.
A2 = 1 selects upper 4 nibble bits 4 . . . 7.
Vali d
Vali d
Vali d
A 10/A P
Val i d
00
14
03
A [ 9:3]
02
1
Vali d
READ1
02
t CCD
Vali d
READ1
0
t MOD
Tc0
A2
MRS
Tb
A[1:0]
t RF
Ta
3
PREA
T0
Bank add ress
Command
CK#
CK
NOP
Tc4
NOP
Tc5
NOP
Tc6
NOP
Tc7
t MPRR
0
0
0
0
00
0
Vali d
3
MRS
Tc8
t MOD
NOP
Tc10
Indicates a Break in
Time Scale
NOP
Tc9
Don ’t Care
Valid
Td
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 54 - MPR System Read Calibration with BC4: Lower Nibble, Then Upper Nibble
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
DQ
DQS, DQS#
A [ 15:13]
0
0
A12/BC#
0
A 10/A P
0
00
A [ 9:3]
A 11
1
A2
1
0
MRS
A[1:0]
t RF
Ta
3
PREA
T0
Bank add ress
Command
CK#
CK
t MOD
RL
Vali d
Vali d 1
Vali d 1
Val i d
Vali d
Vali d
Val i d
Val i d
Vali d
04
13
Val i d
02
02
READ1
Vali d
t CCD
Tc0
Vali d
READ1
Tb
Notes:
NOP
Tc1
1.
2.
3.
4.
RL
NOP
Tc3
NOP
Tc4
NOP
Tc5
NOP
Tc6
READ with BC4 either by MRS or OTF.
Memory controller must drive 0 on A[1:0].
A2 = 1 selects upper 4 nibble bits 4 . . . 7.
A2 = 0 selects lower 4 nibble bits 0 . . . 3.
NOP
Tc2
t MPRR
NOP
Tc7
0
0
0
0
00
0
t MOD
NOP
Tc9
Indicates a Break in
Time Scale
Vali d
3
MR S
Tc8
NOP
Tc10
Don ’t Care
Valid
Td
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 55 - MPR System Read Calibration with BC4: Upper Nibble, Then Lower Nibble
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
MPR READ PREDEFINED PATTERN
7KHSUHGHWHUPLQHG5($'FDOLEUDWLRQSDWWHUQLVDIL[HGSDWWHUQRI7KHIROORZLQJLVDQH[DPSOHRIXVLQJWKH5($'RXWSUHGHWHUPLQHG5($'
FDOLEUDWLRQSDWWHUQ7KHH[DPSOHLVWRSHUIRUPPXOWLSOH5($'6IURPWKH08/7,385326(5(*,67(5035LQRUGHUWRGRV\VWHPOHYHO5($'WLPLQJFDOLEUDWLRQEDVHGRQWKHSUHGHWHUPLQHGDQGVWDQGDUGL]HGSDWWHUQ
7KHIROORZLQJSURWRFRORXWOLQHVWKHVWHSVXVHGWRSHUIRUPWKH5($'FDOLEUDWLRQ
x3UHFKDUJHDOOEDQNV
x$IWHUt53LVVDWLVILHGVHW05605>@ DQG05>@ 7KLVUHGLUHFWVDOOVXEVHTXHQW5($'VDQG/RDGVWKHSUHGHILQHGSDWWHUQLQWR
WKH035$VVRRQDVtMRD and t02'DUHVDWLVILHGWKH035LVDYDLODEOH
x'DWD:5,7(RSHUDWLRQVDUHQRWDOORZHGXQWLOWKH035UHWXUQVWRWKHQRUPDO6'5$0VWDWH
x,VVXHD5($'ZLWKEXUVWRUGHULQIRUPDWLRQDOORWKHUDGGUHVVSLQVDUHv'RQuW&DUHw
x$>@ GDWDEXUVWRUGHULVIL[HGVWDUWLQJDWQLEEOH
x$ IRU%/EXUVWRUGHULVIL[HGDV
x$ XVH%/
x$IWHU5/ $/&/WKH6'5$0EXUVWVRXWWKHSUHGHILQHG5($'FDOLEUDWLRQSDWWHUQ
x7KHPHPRU\FRQWUROOHUUHSHDWVWKHFDOLEUDWLRQ5($'VXQWLO5($'GDWDFDSWXUHDWWKHPHPRU\FRQWUROOHULVRSWLPL]HG
x$IWHUWKHODVW0355($'EXUVWDQGDIWHU t0355KDVEHHQVDWLVILHGLVVXH05605>@ DQG05>@ v'RQuW&DUHwWRWKHQRUPDO
6'5$0VWDWH$OOVXEVHTXHQW5($'DQG:5,7(DFFHVVHVZLOOEHUHJXODU5($'6DQG:5,7(6IURPWRWKH6'5$0DUUD\
x:KHQ tMRD and t02'DUHVDWLVILHGIURPWKHODVW056WKHUHJXODU6'5$0FRPPDQGVVXFKDV$&7,9$7(D0HPRU\EDQNIRUUHJXODU
5($'RU:5,7(DFFHVVDUHSHUPLWWHG
MODE REGISTER SET (MRS)
7KHPRGHUHJLVWHUVDUHORDGHGYLDLQSXWV%$>@$>@%$>@GHWHUPLQHVZKLFKPRGHUHJLVWHULVSURJUDPPHG
x%$
x%$
x%$
x%$
%$
%$
%$
%$
%$
%$
%$
%$
IRU05
IRU05
IRU05
IRU05
7KH056FRPPDQGFDQRQO\EHLVVXHGRUUHLVVXHGZKHQDOOEDQNVDUHLGOHDQGLQWKHSUHFKDUJHGVWDWHt53LVVDWLVILHGDQGQRGDWDEXUVWVDUHLQ
SURJUHVV7KHFRQWUROOHUPXVWZDLWWKHVSHFLILHGWLPHt05'EHIRUHLQLWLDWLQJDVXEVHTXHQWRSHUDWLRQVXFKDVDQ$&7,9$7(FRPPDQG7KHUHLVDOVR
DUHVWULFWLRQDIWHULVVXLQJDQ056FRPPDQGZLWKUHJDUGWRZKHQWKHXSGDWHGIXQFWLRQVEHFRPHDYDLODEOH7KLVSDUDPHWHULVVSHFLILHGE\tMOD. Both
tMRD and t02'SDUDPHWHUVDUHVKRZQLQ)LJXUHDQG9LRODWLQJHLWKHURIWKHVHUHTXLUHPHQWVZLOOUHVXOWLQXQVSHFLILHGRSHUDWLRQ
ZQ CALIBRATION
7KH=4&$/,%5$7,21FRPPDQGLVXVHGWRFDOLEUDWHWKH6'5$0RXWSXWGULYHUV521DQG2'7YDOXHV5TTRYHUSURFHVVYROWDJHDQGWHPSHUDWXUHSURYLGHGDGHGLFDWHG:”H[WHUQDOUHVLVWRULVFRQQHFWHGIURPWKH6'5$0uV=4EDOOWR9VV4
''56'5$0VQHHGDORQJHUWLPHWRFDOLEUDWH5ONDQG2'7DWSRZHUXS,1,7,$/,=$7,21DQG6(/)5()5(6+H[LWDQGDUHODWLYHO\VKRUWHUWLPHWRSHUIRUP
SHULRGLFFDOLEUDWLRQV''56'5$0GHILQHVWZR=4&$/,%5$7,21FRPPDQGV=4&$/,%5$7,21/21*=4&/DQG=4&$/,%5$7,216+257=4&6
$QH[DPSOHRI=4&$/,%5$7,21WLPLQJLVVKRZQLQ)LJXUH
$OOEDQNVPXVWEH35(&+$5*('DQGt53PXVWEHPHWEHIRUH=4&/RU=4&6FRPPDQGVFDQEHLVVXHGWRWKH6'5$01RRWKHUDFWLYLWLHVRWKHUWKDQDQRWKHU
=4&/RU=4&6FRPPDQGPD\EHLVVXHGWRWKH6'5$0FDQEHSHUIRUPHGRQWKH6'5$0DUUD\E\WKHFRQWUROOHUIRUWKHGXUDWLRQRI t=4,1,7RU t=423(5
7KHTXLHWWLPHRQWKH6'5$0DUUD\KHOSVDFFXUDWHO\FDOLEUDWH5ONDQG2'7$IWHU6'5$0FDOLEUDWLRQLVDFKLHYHGWKH6'5$0VKRXOGGLVDEOHWKH=4EDOOuV
FXUUHQWFRQVXPSWLRQSDWKWRUHGXFHRYHUDOOSRZHUXVDJH
=4&$/,%5$7,21FRPPDQGVFDQEHLVVXHGLQSDUDOOHOWR'//5(6(7DQGORFNLQJWLPH8SRQ6(/)5()5(6+H[LWDQH[SOLFLW=4&/LVUHTXLUHGLI=4&$/,%5$7,21LVGHVLUHG
,QGXDOUDQNV\VWHPGHVLJQVWKDWVKDUHWKH=4UHVLVWRUEHWZHHQGHYLFHVWKHFRQWUROOHUPXVWQRWDOORZRYHUODSRIt=4,17t=423(5RUt=4&6EHWZHHQUDQNV
LOGIC Devices Incorporated
www.logicdevices.com
105
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
L9D3256M32DBG2
L9D3512M32DBG2
PRELIMINARY INFORMATION
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 56 - ZQ CALIBRATION TIMING (ZQCL AND ZQCS)
T0
T1
Ta0
Ta1
Ta2
Ta3
Tb0
Tb1
Tc0
Tc1
Tc2
ZQCL
NOP
NOP
NOP
Valid
Vali d
ZQCS
NOP
NOP
NOP
Valid
Address
Vali d
Vali d
Vali d
A10
Vali d
Vali d
Vali d
CK#
CK
Command
CKE
1
Vali d
Vali d
1
Vali d
ODT
2
Vali d
Vali d
2
Vali d
DQ
3
A ctivities
3
High-Z
Activities
High-Z
t ZQ INIT or t ZQ OPER
t ZQCS
Indicates a Break in
Time Scale
Don ’t Care
127(6
1.
&.(PXVWEHFRQWLQXRXVO\UHJLVWHUHG+,*+GXULQJWKHFDOLEUDWLRQSURFHGXUH
2.
2'7PXVWEHGLVDEOHGYLDWKH2'7VLJQDORUWKH056GXULQJWKHFDOLEUDWLRQSURFHGXUH
3.
$OOGHYLFHVFRQQHFWHGWRWKH'4EXVVKRXOGEH+LJK=GXULQJFDOLEUDWLRQ
ACTIVATE
%HIRUHDQ\5($'RU:5,7(FRPPDQGVFDQEHLVVXHGWRDEDQNZLWKLQWKH6'5$0D52:LQWKDWEDQNPXVWEHRSHQHG$&7,9$7('7KLVLVDFFRPSOLVKHG
YLDWKH$&7,9$7(FRPPDQGZKLFKVHOHFWVERWKWKH%$1.DQGWKH52:WREH$&7,9$7('
$IWHUD52:LVRSHQHGZLWKDQ$&7,9$7(FRPPDQGD5($'RU:5,7(FRPPDQGPD\EHLVVXHGWRWKDW52:VXEMHFWWRWKHt5&'VSHFLILFDWLRQ+RZHYHULI
WKHDGGLWLYHODWHQF\LVSURJUDPPHGFRUUHFWO\D5($'RU:5,7(FRPPDQGPD\EHLVVXHGSULRUWRt5&'0,1,QWKLVRSHUDWLRQWKH6'5$0HQDEOHVD5($'
RU:5,7(FRPPDQGWREHLVVXHGDIWHUWKH$&7,9$7(FRPPDQGIRUWKDWEDQNEXWSULRUWRt5&'0,1VHHv3267('&$6$'',7,9(/$7(1&<$/t5&'
0,1VKRXOGEHGLYLGHGE\WKHFORFNSHULRGDQGURXQGHGXSWRWKHQH[WZKROHQXPEHUWRGHWHUPLQHWKHHDUOLHVWFORFNHGJHDIWHUWKH$&7,9$7(FRPPDQGRQ
ZKLFKWKH5($'RU:5,7(FRPPDQGFDQEHHQWHUHG7KHVDPHSURFHGXUHLVXVHGWRFRQYHUWRWKHUVSHFLILFDWLRQOLPLWVIURPWLPHXQLWVWRFORFNF\FOHV
:KHQDWOHDVWRQHEDQNLVRSHQDQ\5($'WR5($'FRPPDQGGHOD\RU:5,7(WR:5,7(FRPPDQGGHOD\LVUHVWULFWHGWRt&&'0,1
$ VXEVHTXHQW $&7,9$7( FRPPDQG WR D GLIIHUHQW 52: LQ WKH VDPH %$1. FDQ RQO\ EH LVVXHG DIWHU WKH SUHYLRXV $&7,9( 52: KDV EHHQ FORVHG 35(&+$5*('7KHPLQLPXPWLPHLQWHUYDOEHWZHHQVXFFHVVLYH$&7,9$7(FRPPDQGVWRWKHVDPH%$1.LVGHILQHGE\t5&
$VXEVHTXHQW$&7,9$7(FRPPDQGWRDQRWKHU%$1.FDQEHLVVXHGZKLOHWKHILUVW%$1.LVEHLQJDFFHVVHGZKLFKUHVXOWVLQDUHGXFWLRQRIWRWDO52:$&&(66
RYHUKHDG7KHPLQLPXPWLPHLQWHUYDOEHWZHHQVXFFHVVLYH$&7,9$7(FRPPDQGVPD\EHLVVXHGLQDJLYHQt)$:0,1SHULRGDQGWKHt55'0,1UHVWULFWLRQ
VWLOODSSOLHV7KHt)$:0,1SDUDPHWHUDSSOLHVUHJDUGOHVVRIWKHQXPEHURI%$1.6DOUHDG\RSHQHGRUFORVHG
LOGIC Devices Incorporated
www.logicdevices.com
106
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 57 - EXAMPLE: MEETING tRRD (MIN) AND tRCD (MIN)
T0
T1
T2
T3
T4
T5
T8
T9
T10
T11
Command
ACT
NOP
NOP
ACT
NOP
NOP
NOP
NOP
NOP
RD/WR
Add ress
Row
BA[2:0]
Bank x
CK#
CK
Row
Col
Bank y
Bank y
t RRD
t RCD
Indicates a Break in
Time Scale
Don ’t Care
FIGURE 58 - EXAMPLE: tFAW
CK#
T0
T1
T4
T5
T8
T9
T10
T11
T19
T20
ACT
NOP
ACT
NOP
A CT
NOP
ACT
NOP
NOP
A CT
CK
Command
Add ress
BA[2:0]
Row
Bank a
Row
Row
Row
Row
Bank b
Bank c
Bank d
Bank ye
t RRD
t FAW
Indicates a Break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
Don ’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
READ
5($'EXUVWVDUHLQLWLDWHGZLWKD5($'FRPPDQG7KHVWDUWLQJ&2/801DQG%$1.DGGUHVVHVDUHSURYLGHGZLWKWKH5($'FRPPDQGDQG $87235(&+$5*(LVHLWKHUHQDEOHGRUGLVDEOHGIRUWKDWEXUVWDFFHVV,I$87235(&+$5*(LVHQDEOHGWKH52:EHLQJDFFHVVHGLVDXWRPDWLFDOO\35(&+$5*('DW
WKHFRPSOHWLRQRIWKHEXUVWVHTXHQFH,I$87235(&+$5*(LVGLVDEOHGWKH52:ZLOOEHOHIWRSHQDIWHUWKHFRPSOHWLRQRIWKHEXUVW
'XULQJ5($'EXUVWVWKHYDOLGGDWDRXWHOHPHQWIURPWKHVWDUWLQJFROXPQDGGUHVVLVDYDLODEOHDW5($'/$7(1&<5/FORFNVODWHU5/LVGHILQHGDVWKHVXP
RI3267('&$6$'',7,9(/$7(1&<$/DQG&$6/$7(1&<&/5/ $/&/7KHYDOXHRI$/DQG&/LVSURJUDPPDEOHLQWKHPRGHUHJLVWHUYLDWKH
056FRPPDQG(DFKVXEVHTXHQWGDWDRXWHOHPHQWZLOOEHYDOLGQRPLQDOO\DWWKHQH[WSRVLWLYHRUQHJDWLYHFORFNHGJHWKDWLVDWWKHQH[WFURVVLQJRI&.DQG
&.?)LJXUHVKRZVDQH[DPSOHRI5/EDVHGRQD&/VHWWLQJRIDVZHOODV$/ FIGURE 59 - READ LATENCY
T0
T7
T8
T9
T10
T11
T12
T12
Command
READ
NOP
NOP
NOP
NOP
NOP
NOP
NOP
Add ress
Bank a,
Col n
CK#
CK
CL = 8, AL = 0
DQS, DQS#
DO
n
DQ
Indicates a Break in
Time Scale
Notes:
Don ’t Care
1. DO n = data-out from column n.
2. Subsequent elements of data-out appear in the programmed order following DO
. n.
/>[email protected]'46[/>[email protected]'46[?LVGULYHQE\WKH6'5$0DORQJZLWKWKHRXWSXWGDWD
7KHLQLWLDO/2:VWDWHRQ/>[email protected]'46[DQG+,*+VWDWHRQ/>[email protected]'46[?LVNQRZQ
DVWKH5($'SUHDPEOHt535(7KH/2:VWDWHRQ'46[DQGWKH+,*+
VWDWHRQ/>[email protected]'46[?FRLQFLGHQWZLWKWKHODVWGDWDRXWHOHPHQWLVNQRZQDV
WKH5($'SRVWDPEOHt53678SRQFRPSOHWLRQRIDEXUVWDVVXPLQJQR
RWKHUFRPPDQGVKDYHEHHQLQLWLDWHGWKH'4ZLOOJR+,*+=$GHWDLOHG
H[SODQDWLRQRI t'464YDOLGGDWDRXWVNHZ t4+GDWDRXWZLQGRZKROG
DQGWKHYDOLGGDWDZLQGRZDUHGHSLFWHGLQ)LJXUH$GHWDLOHGH[SODQDWLRQRIt'46&.'46WUDQVLWLRQVNHZWR&.LVDOVRGHSLFWHGLQ)LJXUH
$5($'EXUVWPD\EHIROORZHGE\D35(&+$5*(FRPPDQGWRWKHVDPH
EDQN SURYLGHG $872 35(&+$5*( LV QRW $&7,9$7(' 7KH PLQLPXP
5($'WR35(&+$5*(FRPPDQGVSDFLQJWRWKHVDPHEDQNLVIRXUFORFNV
DQGPXVWDOVRVDWLVI\DPLQLPXPDQDORJWLPHIURPWKH5($'FRPPDQG
7KLVWLPHLVFDOOHG t5735($'WR35(&+$5*( t573VWDUWV$/F\FOHV
ODWHUWKDQWKH5($'FRPPDQG([DPSOHVIRU%/DUHVKRZQLQ)LJXUH
DQG%&LQ)LJXUH)ROORZLQJWKH35(&+$5*(FRPPDQGDVXEVHTXHQWFRPPDQGWRWKHVDPHEDQNFDQQRWEHLVVXHGXQWLOt53LVPHW7KH
35(&+$5*(FRPPDQGIROORZHGE\DQRWKHU35(&+$5*(FRPPDQGWR
WKHVDPHEDQNLVDOORZHG+RZHYHUWKHSUHFKDUJHSHULRGZLOOEHGHWHUPLQHGE\WKHODVW35(&+$5*(FRPPDQGLVVXHGWRWKHEDQN
'DWDIURPDQ\5($'EXUVWPD\EHFRQFDWHQDWHGZLWKGDWDIURPDVXEVHTXHQW5($'FRPPDQGWRSURYLGHDFRQWLQXRXVIORZRIGDWD7KHILUVWGDWD
HOHPHQWIURPWKHQHZEXUVWIROORZVWKHODVWHOHPHQWRIDFRPSOHWHGEXUVW
7KH QHZ 5($' FRPPDQG VKRXOG EH LVVXHG t&&' F\FOHV DIWHU WKH ILUVW
5($'FRPPDQG7KLVLVVKRZQIRU%/LQ)LJXUH,I%&LVHQDEOHG
t&&'PXVWVWLOOEHPHWZKLFKZLOOFDXVHDJDSLQWKHGDWDRXWSXWDVVKRZQ
LQ)LJXUH1RQFRQVHFXWLYH5($'GDWDLVUHIOHFWHGLQ)LJXUH''5
6'5$0VGRQRWDOORZLQWHUUXSWLQJRUWUXQFDWLQJDQ\5($'EXUVW
,I$LV+,*+ZKHQD5($'FRPPDQGLVLVVXHGWKH5($'ZLWK$872
35(&+$5*( IXQFWLRQ LV HQJDJHG 7KH 6'5$0 VWDUWV DQ $872 35(&+$5*(RSHUDWLRQRQWKHULVLQJHGJHZKLFKLV$/t573F\FOHVDIWHUWKH
5($' FRPPDQG ''5 6'5$0V VXSSRUW D t5$6 ORFNRXW IHDWXUH VHH
)LJXUH,I t5$60,1LVQRWVDWLVILHGDWWKHHGJHWKHVWDUWLQJSRLQWRI
WKH$87235(&+$5*(RSHUDWLRQZLOOEHGHOD\HGXQWLOt5$60,1LVVDWLVILHG,QFDVHWKHLQWHUQDO35(&+$5*(RSHUDWLRQLVSXVKHGRXWE\t573
t53VWDUWVDWWKHSRLQWDWZKLFKWKHLQWHUQDO35(&+$5*(KDSSHQV7KH
WLPH IURP 5($' ZLWK $872 35(&+$5*( WR WKH QH[W $&7,9$7( FRPPDQGWKHVDPHEDQNLV$/t573t53ZKHUHvwPHDQVURXQGHGXS
WRWKHQH[WLQWHJHU,QDQ\HYHQWLQWHUQDO5(&+$5*(GRHVQRWVWDUWHDUOLHU
WKDQIRXUFORFNVDIWHUWKHODVWQELWSUHIHWFK
'DWDIURPDQ\5($'EXUVWPXVWEHFRPSOHWHGEHIRUHDVXEVHTXHQW:5,7(
EXUVWLVDOORZHG$QH[DPSOHRID5($'EXUVWIROORZHGE\D:5,7(EXUVW
IRU %/ LV VKRZQ LQ )LJXUH 7R HQVXUH WKH 5($' GDWD LV FRPSOHWHG
EHIRUHWKH:5,7(GDWDLVRQWKHEXVWKHPLQLPXP5($'WR:5,7(WLPLQJ
LV5/t&&'y:/t&.
LOGIC Devices Incorporated
Transitioning Data
www.logicdevices.com
108
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
Bank,
Col n
Add ress 2
DQ3
DQS, DQS#
REA D
T0
Command 1
CK
CK#
Notes:
NOP
T1
1.
2.
3.
4.
109
RL = 5
NOP
T3
Bank,
Col b
REA D
T4
t RPRE
NOP
T5
DO
n
DO
n+1
NOP
T6
DO
n+3
RL = 5
DO
n+2
DO
n+4
NOP
T7
DO
n+5
DO
n+6
NOP
T8
DO
n+7
NOP
T9
DO
b
DO
b+1
DO
b+2
NOP
T10
DO
b+3
DO
b+4
NO P
T11
DO
b+5
NOP
T12
DO
b+7
Transitioning Data
DO
b+6
t RPST
NOP
T13
Don ’t Care
NOP
T14
NOP commands are shown for ease of illustration; other commands may be valid at these times.
The BL8 setting is activated by either MR0[1:0] = 00 or MR0[1:0] = 01 and A12 = 1 during READ command at T0 and T4.
DO n (or b) = data-out from column n (or column b).
BL8, RL = 5 (CL = 5, AL = 0).
t CCD
NOP
T2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 60 - Consecutive READ Bursts (BL8)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
Bank,
Col n
Address 2
DQ3
DQS, DQS#
READ
T0
Comman d 1
CK
CK#
Notes:
NOP
T1
1.
2.
3.
4.
110
RL = 5
NOP
T3
Bank,
Col b
READ
T4
t RPRE
NOP
T5
DO
n
DO
n+1
NOP
T6
RL = 5
DO
n+2
DO
n+3
t RPST
NOP
T7
NOP
T8
t RPRE
NOP
T9
DO
b
DO
b+1
NOP
T10
DO
b+2
DO
b+3
t RPST
NOP
T11
NOP
T13
Transitioning Data
NOP
T12
Don ’t Care
NOP
T14
NOP commands are shown for ease of illustration; other commands may be valid at these times.
The BC4 setting is activated by either MR0[1:0] = 10 or MR0[1:0] = 01 and A12 = 0 during READ command at T0 and T4.
DO n (or b) = data-out from column n (or column b).
BC4, RL = 5 (CL = 5, AL = 0).
t CCD
NOP
T2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 61 - Consecutive READ Bursts (BC4)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
DQ
DQS, DQS#
READ
Bank a,
Col n
Add ress
T0
Command
CK
CK#
Notes:
NOP
T1
1.
2.
3.
4.
NOP
T2
CL = 8
NOP
T4
Bank a,
Col b
READ
T5
NOP
T6
NOP
T7
DO
n
NOP
T8
CL = 8
NOP
T9
NOP
T10
NOP
T11
NOP
T12
NOP
T13
DO
b
AL = 0, RL = 8.
DO n (or b) = data-out from column n (or column b).
Seven subsequent elements of data-out appear in the programmed order following DO n.
Seven subsequent elements of data-out appear in the programmed order following DO b.
NOP
T3
NOP
T14
NOP
T15
Transitioning Data
NOP
T16
Don ’t Care
NOP
T17
PRELIMINARY INFORMATION
111
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 62 - Nonconsecutive READ Bursts
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
Bank,
Col n
Add ress 2
112
DQ3
DQS, DQS#
READ
T0
Command 1
CK
CK#
NOP
T2
NOP
T3
NOP
T4
NOP
T5
Notes:
DO
n
DO
n+1
DO
n+2
Bank,
Col b
WRITE
T6
DO
n+3
DO
n+4
NOP
T7
DO
n+5
NOP
T9
DO
n+7
t RPST
WL = 5
DO
n+6
NOP
T8
NOP
T10
t WPRE
DI
n
NOP
T11
DI
n+1
DI
n+2
NOP
T12
DI
n+3
DI
n+5
DI
n+6
NOP
T14
Transitioning Data
DI
n+4
t BL = 4 clocks
NOP
T13
Don ’t Care
DI
n+7
t WPST
t WTR
t WR
NOP
T15
1. NOP commands are shown for ease of illustration; other commands may be valid at these times.
2. The BL8 setting is activated by either MR0[1:0] = 00 or MR0[1:0] = 01 and A12 = 1 during the READ command at T0, and
the WRITE command at T6.
RL = 5
t RPRE
READ-to-WRITE command delay = RL + t CCD + 2t CK - WL
NOP
T1
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 63 - READ (BL8) to WRITE (BL8)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
DQ3
DQS, DQS#
Add ress2
Command 1
CK
CK#
NOP
T1
NOP
T2
NOP
T3
WRITE
T4
Bank,
Col n
Notes:
1.
2.
3.
4.
113
DO
n
NOP
T5
DO
n +1
NOP
T7
DO
n+ 3
t RPST
WL = 5
DO
n +2
NOP
T6
NOP
T8
t WPRE
DI
n
NOP
T9
DI
n +1
DI
n +2
NOP
T10
DI
n +3
t WPST
t BL = 4 clo cks
NOP
T11
NOP
T12
T14
t WR
t WTR
NOP
Transitioning Data
NOP
T13
NOP
T15
Don ’t Care
NOP commands are shown for ease of illustration; other commands may be valid at these times.
The BC4 OTF setting is activated by MR0[1:0] and A12 = 0 during READ command at T0 and WRITE command at T4.
DO n = data-out from column n; DI n = data-in from column b.
BC4, RL = 5 (AL - 0, CL = 5), WL = 5 (AL = 0, CWL = 5).
RL = 5
t RPRE
Bank,
Col b
READ-to-WRITE command delay = RL + t CC D/2 + 2 t CK - WL
READ
T0
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 64 - READ (BC4) to WRITE (BC4) OTF
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
Bank,
Col n
Add ress 2
DQ3
DQS, DQS#
READ
T0
Command 1
CK
CK#
NOP
T2
NOP
T3
NOP
T4
NOP
T5
Notes:
DO
n
DO
n+1
DO
n+2
Bank,
Col b
WRITE
T6
DO
n+3
DO
n+4
NOP
T7
DO
n+5
NOP
T9
DO
n+7
t RPST
WL = 5
DO
n+6
NOP
T8
NOP
T10
t WPRE
DI
n
NOP
T11
DI
n+1
DI
n+2
NOP
T12
DI
n+3
DI
n+5
DI
n+6
NOP
T14
Transitioning Data
DI
n+4
t BL = 4 clocks
NOP
T13
Don ’t Care
DI
n+7
t WPST
t WTR
t WR
NOP
T15
1. NOP commands are shown for ease of illustration; other commands may be valid at these times.
2. The BL8 setting is activated by either MR0[1:0] = 00 or MR0[1:0] = 01 and A12 = 1 during the READ command at T0, and
the WRITE command at T6.
3. DO n = data-out from column, DI b = data-in for column b.
4. BL8, RL = 5 (AL = 0, CL = 5), WL = 5 (AL = 0, CWL = 5).
RL = 5
t RPRE
READ-to-WRITE command delay = RL + t CCD + 2t CK - WL
NOP
T1
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 65 - READ to PRECHARGE (BL8)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ACT
PRE
Don ’t Care
DO
n+3
DO
n+2
NOP
115
DQ
Add ress
DQS, DQS#
READ
Bank a,
Col n
Command
NOP
T2
T1
T0
www.logicdevices.com
CK
C K#
LOGIC Devices Incorporated
t RAS
t RTP
T3
NOP
T4
NOP
T5
Bank a,
(or all)
T6
NOP
T7
NOP
T8
NOP
DO
n
DO
n+1
t RP
T9
NOP
T10
NOP
NOP
T11
T12
NOP
Bank a,
Row b
T13
T14
NOP
T15
NOP
T16
NOP
Transitioning Data
NOP
T17
Figure 66 - READ to PRECHARGE (BC4)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
LOGIC Devices Incorporated
www.logicdevices.com
RL = AL + CL = 11
CL = 6
AL = 5
DQ
DQS, DQS#
CK
Command
BC4
CK#
T0
ACTIVE n
T1
READ n
t RCD (MIN)
T2
NOP
T6
NOP
T11
NOP
T12
NOP
Indicates a Break in
Time Scale
DO
n
DO
n+1
T13
NOP
DO
n+2
Transitioning Data
DO
n+3
T14
NOP
Don’t Care
Figure 67 - READ to PRECHARGE (AL = 5, CL = 6)
116
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
LOGIC Devices Incorporated
www.logicdevices.com
Don ’t Care
t RP
Indicates A Break in
Time Scale
DO
n+2
t RAS (MIN)
CL = 6
t RTP (MIN)
AL = 4
DQ
Add ress
DQS, DQS#
READ
Bank a,
Col n
Command
CK
CK#
T0
T1
NOP
T2
NOP
T3
NOP
T4
NOP
T5
NOP
T6
NOP
T7
NOP
T8
NOP
T9
NOP
T10
NOP
DO
n
DO
n+1
NOP
T11
DO
n+3
T12
NOP
T13
NOP
Transitioning Data
Bank a,
Row b
NOP
Ta0
ACT
Figure 68 - READ with Auto Precharge (AL = 4, CL = 6)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
READ
$'46[WR'4RXWSXWWLPLQJLVVKRZQLQ)LJXUH7KH'4WUDQVLWLRQVEHWZHHQYDOLGGDWDRXWSXWVPXVWEHZLWKLQt'464RIWKHFURVVLQJSRLQWRI/>[email protected]'46[
/>[email protected]'46[?'46PXVWDOVRPDLQWDLQDPLQLPXP+,*+DQG/2:WLPHRIt46+DQGt46/3ULRUWRWKH5($'SUHDPEOHWKH'4EDOOVZLOOHLWKHUEHIORDWLQJRU
WHUPLQDWHGGHSHQGLQJRQWKHVWDWXVRIWKH2'7VLJQDO
)LJXUHVKRZVWKHVWUREHWRFORFNWLPLQJGXULQJD5($'7KHFURVVLQJSRLQW'46['46[?PXVWWUDQVLWLRQZLWK”t'46&.RIWKHFORFNFURVVLQJSRLQW7KH
GDWDRXWKDVQRWLPLQJUHODWLRQVKLSWRFORFNRQO\WR'46DVVKRZQLQ)LJXUH
)LJXUHDOVRVKRZVWKH5($'SUHDPEOHDQGSRVWDPEOH1RUPDOO\ERWK'46[DQG'46[?DUH+,*+=WRVDYHSRZHU9DD43ULRUWRGDWDRXWSXWIURPWKH
6'5$0'46[LVGULYHQ/2:DQG'46[?GULYHQ+,*+IRUt535(7KLVLVNQRZQDVWKH5($'SUHDPEOH
7KH5($'SRVWDPEOHt5367LVRQHKDOIFORFNIURPWKHODVW/>[email protected]'46[/>[email protected]'46[?WUDQVLWLRQ'XULQJWKH5($'SRVWDPEOH/>[email protected]'46[LVGULYHQ/2:DQG/>[email protected]
'46[?GULYHQ+,*+:KHQFRPSOHWHWKH'4ZLOOHLWKHUEHGLVDEOHGRUZLOOFRQWLQXHWHUPLQDWLQJGHSHQGLQJRQWKHVWDWHRIWKH2'7VLJQDO)LJXUHGHPRQVWUDWHVKRZWRPHDVXUHt5367
LOGIC Devices Incorporated
www.logicdevices.com
118
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
119
Notes:
All DQ collectively
DQ3 (first data no lon ger valid)
DQ3 (last data valid)
1.
2.
3.
4.
5.
6.
7.
Bank,
Col n
Add ress 2
DQS, DQS#
READ
T0
Command 1
CK
CK#
NOP
T2
RL = AL + CL
NOP
T3
t RPRE
t DQSQ (MAX)
t LZ (DQ) MIN
NOP
T4
Data valid
DO
n
DO
n
t QH
DO
n
NOP
T5
t DQSQ (MAX)
NOP
T7
NOP
T8
t RPST
NOP
T9
DO
n+1
DO
n+2
Data valid
DO
n+3
DO
n+4
DO
n+5
DO
n+7
Transitioning Data
DO
n+6
t QH
DO
DO
DO
DO
DO
DO
DO
n+1
n+2
n+3
n+4
n+5
n+6
n+7
DO
DO
DO
DO
DO
DO
DO
n+3
n+1
n+2
n+4
n+5
n+6
n+7
NOP
T6
Don ’t Care
t HZ (DQ) MAX
NOP
T10
NOP commands are shown for ease of illustration; other commands may be valid at these times.
The BL8 setting is activated by either MR0[1, 0] = 0, 0 or MR0[0, 1] = 0, 1 and A12 = 1 during READ command at T0.
DO n = data-out from column n.
BL8, RL = 5 (AL = 0, CL = 5).
Output timings are referenced to VCCQ/2 and DLL on and locked.
t DQSQ defines the skew between DQS, DQS# to data and does not define DQS, DQS# to clock.
Early data transitions may not always happen at the same DQ. Data transitions of a DQ can vary (either early or late)
within a burst.
NOP
T1
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 69 - Data Output Timing – tDQSQ and Data Valid Window
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
OUTPUT TIMING
t+=DQG t/=WUDQVLWLRQVRFFXULQWKHVDPHDFFHVVWLPHDVYDOLGGDWDWUDQVLWLRQV7KHVHSDUDPHWHUVDUHUHIHUHQFHGWRDVSHFLILFYROWDJHOHYHOZKLFKVSHFLILHV
ZKHQWKHGHYLFHRXWSXWLVQRORQJHUGULYLQJt+='46DQGt+='4RUEHJLQVGULYLQJt/='46t/='4)LJXUHVKRZVDPHWKRGWRFDOFXODWHWKHSRLQW
ZKHQWKHGHYLFHLVQRWORQJHUGULYLQJ t+='46DQG t+='4RUEHJLQVGULYLQJ t/='46 t/='4E\PHDVXULQJWKHVLJQDODWWZRGLIIHUHQWYROWDJHV7KH
DFWXDOYROWDJHPHDVXUHPHQWSRLQWVDUHQRWFULWLFDODVORQJDVWKHFDOFXODWLRQLVFRQVLVWHQW7KHSDUDPHWHUVt/='46t/='4t+='46DQGt+='4DUH
GHILQHGDVVLQJOHHQGHG
LOGIC Devices Incorporated
www.logicdevices.com
120
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
DQS, DQS#
late strobe
DQS, DQS#
early strobe
CK#
CK
t LZ (DQS)MIN
121
t RPRE
t RPRE
Bit 0
Bit 0
t QSH
Bit 2
Bit 1
t QSL
t QSL
t QSL
Bit 2
t QSH
Bit 3
Bit 4
Bit 5
t QSL
Bit 4
Bit 5
Bit 6
Bit 7
t RPST
Bit 6
Bit 7
t RPST
t HZ (DQS) MAX
T5
t HZ (DQS) MIN
t DQSCK(MAX)
T4
t DQSCK(MIN)
t DQSCK(MAX)
T3
t DQSCK(MIN)
t DQSCK(MAX)
Bit 3
t QSH
T2
t DQSCK(MIN)
t DQSCK(MAX)
Bit 1
t QSH
T1
t DQSCK(MIN)
t LZ (DQS)MAX
T0
RL measured
to this point
T6
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 70 - Data Strobe Timing – READs
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
Figure 71 - Method for Calculating tLZ and tHZ
VOH - xmV
VTT + 2xmV
VOH - 2xmV
VTT + xmV
t LZ (DQS), t LZ (DQ)
t HZ (DQS), t HZ (DQ)
T2
T1
VOL + 2xmV
VTT - xmV
VOL + xmV
VTT - 2xmV
LOGIC Devices Incorporated
T2
t LZ (DQS),t LZ (DQ) begin point = 2 × T1 - T2
t HZ (DQS),t HZ (DQ) end point = 2 × T1 - T2
Notes:
T1
1. Within a burst, the rising strobe edge is not necessarily fixed at t DQSCK (MIN) or t DQSCK
(MAX). Instead, the rising strobe edge can vary between t DQSCK (MIN) and t DQSCK (MAX).
2. The DQS high pulse width is defined by t QSH, and the DQS low pulse width is defined by
t QSL. Likewise, t LZ (DQS) MIN and t HZ (DQS) MIN are not tied to t DQSCK (MIN) (early strobe
case) and t LZ (DQS) MAX and t HZ (DQS) MAX are not tied to t DQSCK (MAX) (late strobe
case); however, they tend to track one another.
3. The minimum pulse width of the READ preamble is defined by t RPRE (MIN). The minimum
pulse width of the READ postamble is defined by t RPST (MIN).
www.logicdevices.com
122
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 72 - tRPRE TIMING
CK
VTT
CK#
tA
tB
DQS
VTT
Single-ended signal, provided
as background information
tC
tD
VTT
DQS#
Single-ended signal, provided
as background information
T1
t RPRE begins
DQS - DQS#
t RPRE
0V
T2
t RPRE ends
Resultin g differential
signal relevant for
t RPRE specification
FIGURE 73 - tRPST TIMING
CK
VTT
CK#
tA
DQS
Single-ended signal, provided
as background information
VTT
tB
tC
tD
DQS#
VTT
Single-ended signal, provided
as background information
t RPST
DQS - DQS#
Resultin g differential
signal relevant for
t RPST specification
LOGIC Devices Incorporated
www.logicdevices.com
0V
T1
t RPST begins
123
T2
t RPST ends
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 74 - tWPRE TIMING
CK
VTT
CK#
T1
t WPRE begins
DQS - DQS#
0V
t WPRE
T2
t WPRE ends
Resulting differential
signal relevant for
t WPRE specification
FIGURE 75 - tWPST TIMING
CK
VTT
CK#
t WPST
DQS - DQS#
Resulting differential
signal relevant for
t WPST specification
LOGIC Devices Incorporated
www.logicdevices.com
0V
T1
t WPST begins
T2
t WPST ends
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
WRITE
:5,7(EXUVWVDUHLQLWLDWHGZLWKD:5,7(FRPPDQG7KHVWDUWLQJ&2/801DQG%$1.DGGUHVVHVDUHSURYLGHGZLWKWKH:5,7(FRPPDQGDQG$87235(&+$5*(LVVHOHFWHGWKH52:EHLQJDFFHVVHGZLOOEH35(&+$5*('DWWKHHQGRI:5,7(EXUVW,I$87235(&+$5*(LVQRWVHOHFWHGWKH52:ZLOOUHPDLQ
RSHQIRUVXEVHTXHQWDFFHVVHV$IWHUD:5,7(FRPPDQGKDVEHHQLVVXHGWKH:5,7(EXUVWPD\QRWEHLQWHUUXSWHG)RUWKHJHQHULF:5,7(FRPPDQGVXVHG
LQ)LJXUHWKRXJK)LJXUH$87235(&+$5*(LVGLVDEOHG
'XULQJ:5,7(EXUVWVWKHILUVWYDOLGGDWDLQHOHPHQWLVUHJLVWHUHGRQDULVLQJHGJHRI'46[IROORZLQJWKH:5,7(/$7(1&<:/FORFNVODWHUDQGVXEVHTXHQW
GDWDHOHPHQWVZLOOEHUHJLVWHUHGRQVXFFHVVLYHHGJHVRI'46[:5,7(/$7(1&<:/LVGHILQHGDVWKHVXPRI3267('&$6$'',7,9(/$7(1&<$/DQG
&$6:5,7(/$7(1&<&:/:/ $/&:/7KHYDOXHVRI$/DQG&:/DUHSURJUDPPHGLQWKH05DQG05UHJLVWHUVUHVSHFWLYHO\3ULRUWRWKHILUVW
YDOLG'46[HGJHDIXOOF\FOHLVQHHGHGLQFOXGLQJDGXPP\FURVVRYHURI'46['46[?DQGVSHFLILHGDVWKH:5,7(SUHDPEOHVKRZQLQ)LJXUH7KHKDOI
F\FOHRQ'46[IROORZLQJWKHODVWGDWDLQHOHPHQWLVNQRZQDVWKH:5,7(SRVWDPEOH
7KHWLPHEHWZHHQWKH:5,7(FRPPDQGDQGWKHILUVWYDOLGHGJHRI'46[LV:/FORFNV” t'466)LJXUHWKURXJK)LJXUHVKRZWKHQRPLQDOFDVHZKHUH
t'466 QVKRZHYHU)LJXUHLQFOXGHVt'4660,1DQGt'4660$;FDVHV
'DWDPD\EHPDVNHGIURPFRPSOHWLQJD:5,7(XVLQJGDWDPDVN7KHPDVNRFFXUVRQWKH'0EDOODOLJQHGWRWKH:5,7(GDWD,I'0LV/2:WKH:5,7(
FRPSOHWHVQRUPDOO\,I'0LV+,*+WKDWELWRIGDWDLVPDVNHG
8SRQFRPSOHWLRQRIDEXUVWDVVXPLQJQRRWKHUFRPPDQGVKDYHEHHQLQLWLDWHGWKH'4ZLOOUHPDLQ+,*+=DQGDQ\DGGLWLRQDOLQSXWGDWDZLOOEHLJQRUHG
'DWDIRUDQ\:5,7(EXUVWPD\EHFRQFDWHQDWHGZLWKDVXEVHTXHQW:5,7(FRPPDQGWRSURYLGHDFRQWLQXRXVIORZRILQSXWGDWD7KHQHZ:5,7(FRPPDQG
FDQEHt&&'FORFNVIROORZLQJWKHSUHYLRXV:5,7(FRPPDQG7KHILUVWGDWDHOHPHQWIURPWKHQHZEXUVWLVDSSOLHGDIWHUWKHODVWHOHPHQWRIDFRPSOHWHGEXUVW
)LJXUHVDQGVKRZFRQFDWHQDWHGEXUVWV$QH[DPSOHRIQRQFRQVHFXWLYH:5,7(6LVVKRZQLQ)LJXUH
'DWDIRUDQ\:5,7(EXUVWPD\EHIROORZHGE\DVXEVHTXHQW5($'FRPPDQGDIWHUt:75KDVEHHQPHWVHH)LJXUHVDQG
'DWDIRUDQ\:5,7(EXUVWPD\EHIROORZHGE\DVXEVHTXHQW35(&+$5*(FRPPDQGSURYLGLQJt:5KDVEHHQPHWDVVKRZQLQ)LJXUHDQG)LJXUH
Both t:75DQGt:5VWDUWLQJWLPHPD\YDU\GHSHQGLQJRQWKHPRGHUHJLVWHUVHWWLQJVIL[HG%&%/YV27)
LOGIC Devices Incorporated
www.logicdevices.com
125
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 76 - WRITE BURST
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
T10
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command 1
WL = AL + CWL
Address 2
Bank,
Col n
t DQSS t DSH
t DSH
t DSH
t DSH
t WPRE
t DQSS(MIN)
t WPST
DQS, DQS#
t DQSH
t DQSL t DQSH
DI
n
DQ3
t DQSL t DQSH
DI
n+1
DI
n+2
t DQSL t DQSH
DI
n+3
t DSH
DI
n+4
t DQSL t DQSH
DI
n+5
t DSH
DI
n+6
t DQSL
DI
n+7
t DSH
t DSH
t WPRE
t DQSS(NOM)
t WPST
DQS, DQS#
t DQSH t DQSL
t DQSH
t DSS
DI
n
DQ3
t DQSL t DQSH
t DQSL t DQSH
t DQSL t DQSH
t DQSL
t DSS
t DSS
t DSS
t DSS
DI
n+1
DI
n+2
DI
n+3
DI
n+4
DI
n+5
DI
n+6
DI
n+7
t DQSS
t WPRE
t DQSS(MAX)
t WPST
DQS, DQS#
t DQSH
t DQSL t DQSH
t DSS
DI
n
DQ3
t DQSL t DQSH
t DSS
DI
n+1
t DQSL t DQSH
t DSS
DI
n+2
DI
n+3
t DQSL t DQSH
t DSS
DI
n+4
DI
n+5
t DQSL
t DSS
DI
n+6
DI
n+7
Transitioning Data
Notes:
LOGIC Devices Incorporated
Don ’t Care
1. NOP commands are shown for ease of illustration; other commands may be valid at these
times.
2. The BL8 setting is activated by either MR0[1:0] = 00 or MR0[1:0] = 01 and A12 = 1 during the
WRITE command at T0.
3. DI n = data-in for column n.
4. BL8, WL = 5 (AL = 0, CWL = 5).
5. t DQSS must be met at each rising clock edge.
6. t WPST is usually depicted as ending at the crossing of DQS, DQS#; however, t WPST actually
ends when DQS no longer drives LOW and DQS# no longer drives HIGH.
www.logicdevices.com
126
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 77 - CONSECUTIVE WRITE (BL8) TO WRITE (BL8)
T0
T1
WRITE
NOP
T2
T3
T4
T5
T6
T7
T8
T9
T10
T11
T12
T13
NOP
NOP
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
t BL = 4 clocks
NOP
NOP
T14
C K#
CK
Command 1
t CCD
NOP
t WR
t WTR
Add ress 2
Valid
Valid
t WPST
t WPRE
DQS, DQS#
DI
n
DQ3
DI
n+1
DI
n+2
DI
n+3
DI
n+4
DI
n+5
DI
n+6
DI
n+7
DI
b
DI
b+1
DI
b+2
DI
b+3
DI
b+4
DI
b+5
DI
b+6
DI
b+7
WL = 5
WL = 5
Transitioning Data
Notes:
Don ’t Care
1. NOP commands are shown for ease of illustration; other commands may be valid at these times.
2. The BL8 setting is activated by either MR0[1:0] = 00 or MR0[1:0] = 01 and A12 = 1 during the WRITE commands at
T0 and T4.
3. DI n (or b) = data-in for column n (or column b).
4. BL8, WL = 5 (AL = 0, CWL = 5).
FIGURE 78 - CONSECUTIVE WRITE (BC4) TO WRITE (BC4) VIA MRS OR OTF
T0
T1
WRITE
NOP
T2
T3
T4
T5
T6
T7
T8
T9
T10
NOP
NOP
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
T11
T12
T13
NOP
NOP
NOP
T14
C K#
CK
Command 1
t CCD
t BL = 4 clo cks
NOP
t WR
t WTR
Address2
Vali d
Vali d
t WPRE
t WPST
t WPRE
t WPST
DQS, DQS#
DI
n
DQ3
DI
n+1
DI
n+2
DI
n+3
DI
b
DI
b+1
DI
b+2
DI
b+3
WL = 5
WL = 5
Transitioning Data
Notes:
LOGIC Devices Incorporated
1.
2.
3.
4.
Don ’t Care
NOP commands are shown for ease of illustration; other commands may be valid at these times.
BC4, WL = 5 (AL = 0, CWL = 5).
DI n (or b) = data-in for column n (or column b).
The BC4 setting is activated by MR0[1:0] = 01 and A12 = 0 during the WRITE command at T0 and T4.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 79 - NONCONSECUTIVE WRITE TO WRITE
T0
T1
T2
T3
T4
WRITE
NOP
NOP
NOP
NOP
T5
T6
T7
T8
T9
T10
T11
T12
T13
T14
T15
T16
T17
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
C K#
CK
C ommand
Add ress
NOP
WRITE
Vali d
NOP
NOP
NOP
Vali d
WL = C WL + AL = 7
WL = C WL + AL = 7
DQS, DQS#
DI
n
DQ
DI
n+1
DI
n+2
DI
n+3
DI
n+4
DI
n+5
DI
n+6
DI
n+7
DI
b
DI
b+1
DI
b+2
DI
b+3
DI
b+4
DI
b+5
DI
b+6
DI
b+7
DM
Transitioning Data
Notes:
1.
2.
3.
4.
Don't Care
DI n (or b) = data-in for column n (or column b).
Seven subsequent elements of data-in are applied in the programmed order following DO n.
Each WRITE command may be to any bank.
Shown for WL = 7 (CWL = 7, AL = 0).
FIGURE 80 - WRITE (BL8) TO READ (BL8)
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
T10
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
T11
Ta0
NOP
READ
CK#
CK
Command 1
t WTR 2
Add ress3
Vali d
Vali d
t WPRE
t WPST
DQS, DQS#
DI
n
DQ4
DI
n+1
DI
n+2
DI
n+3
DI
n+4
DI
n+5
DI
n+6
DI
n+7
WL = 5
Indicates a Break in
Time Scale
Notes:
LOGIC Devices Incorporated
Transitioning Data
Don ’t Care
1. NOP commands are shown for ease of illustration; other commands may be valid at these times.
2. t WTR controls the WRITE-to-READ delay to the same device and starts with the first rising clock edge after the last write
data shown at T9.
3. The BL8 setting is activated by either MR0[1:0] = 00 or MR0[1:0] = 01 and MR0[12] = 1 during the WRITE command at T0.
The READ command at Ta0 can be either BC4 or BL8, depending on MR0[1:0] and the A12 status at Ta0.
4. DI n = data-in for column n.
5. RL = 5 (AL = 0, CL = 5), WL = 5 (AL = 0, CWL = 5).
www.logicdevices.com
128
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
Vali d
Add ress3
DQ 4
DQS, DQS#
WRITE
T0
Command 1
CK
CK#
Notes:
129
NOP
T2
WL = 5
NOP
T3
NOP
T4
t WPRE
DI
n
NOP
T5
DI
n+1
DI
n+2
NOP
T6
DI
n+3
T8
NOP
Indicates a Break in
Time Scale
t WPST
NOP
T7
NOP
Transitioning Data
t WTR 2
T9
Don ’t Care
Vali d
READ
Ta0
1. NOP commands are shown for ease of illustrati on; other commands may be valid at these times.
2. t WTR controls the WRITE-to-READ delay to the same device and starts with the first rising clock edge after the last write
data shown at T7.
3. The fixed BC4 setting is activated by MR0[1:0] = 10 during the WRITE command at T0 and the READ command at Ta0.
4. DI n = data-in for column n.
5. BC4 (fixed), WL = 5 (AL = 0, CWL = 5), RL = 5 (AL = 0, CL = 5).
NOP
T1
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 81 - WRITE TO READ (BC4 MODE REGISTER SETTING)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
Vali d
Add ress 3
DQ 4
DQS, DQS#
WRITE
T0
C ommand 1
CK
CK#
Notes:
NOP
T1
130
WL = 5
NOP
T3
NOP
T4
t WPRE
DI
n
NOP
T5
DI
n+1
DI
n+2
NOP
T6
DI
n+3
t WPST
t BL = 4 clo cks
NOP
T7
NOP
T8
NOP
T9
Indicates a Break in
Time Scale
t WTR 2
NOP
T10
Transitioning Data
NOP
T11
RL = 5
Don ’t Care
Vali d
READ
Tn
NOP commands are shown for ease of illustration; other commands may be valid at these times.
t WTR controls the WRITE-to -READ delay to the same device and starts after t BL.
The BC4 OTF setting is activated by MR0[1:0] = 01 and A 12 = 0 during the WRITE command at T0 and the READ command
at Tn.
4. DI n = data-in for column n.
5. BC4, RL = 5 (AL = 0, CL = 5), WL = 5 (AL = 0, CWL = 5).
1.
2.
3.
NOP
T2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 82 - WRITE (BC4 OTF) TO READ (BC4 OTF)
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 83 - WRITE (BL8) TO PRECHARGE
CK#
T0
T1
T2
T3
T4
T5
T6
T7
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
T8
T9
T10
T11
T12
Ta0
Ta1
NOP
NOP
NOP
NOP
NOP
NOP
PRE
CK
Command
Add ress
Vali d
Vali d
t WR
WL = AL + CWL
DQS, DQS#
DI
n
DQ BL8
DI
n+1
DI
n+2
DI
n+3
DI
n+4
DI
n+5
DI
n+6
DI
n+7
Indicates a Break in
Time Scale
Notes:
Transitioning Data
Don ’t Care
1. DI n = data-in from column n.
2. Seven subsequent elements of data-in are applie d in the programmed order following
DO n.
3. Shown for WL = 7 (AL = 0, CWL = 7).
FIGURE 84 - WRITE (BC4 MODE REGISTER SETTING) TO PRECHARGE
CK#
T0
T1
T2
T3
T4
T5
T6
T7
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
T8
T9
T10
T11
T12
Ta0
Ta1
NOP
NOP
NOP
NOP
NOP
NOP
PRE
CK
Comman d
Add ress
Vali d
Vali d
t WR
WL = AL + CWL
DQS, DQS#
DI
n
DQ BC4
DI
n+ 1
DI
n+ 2
DI
n+ 3
Indicates a Break in
Time Scale
Notes:
LOGIC Devices Incorporated
Transitioning Data
Don ’t Care
1. NOP commands are shown for ease of illustration; other commands may be valid at these
times.
2. The write recovery time ( t WR) is referenced from the first rising clock edge after the last
write data is shown at T7. t WR specifies the last burst WRITE cycle until the PRECHARGE
command can be issued to the same bank.
3. The fixed BC4 setting is activated by MR0[ 1:0] = 10 during the WRITE command at T0.
4. DI n = data-in for column n.
5. BC4 (fixed), WL = 5, RL = 5.
www.logicdevices.com
131
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 85 - WRITE (BC4 OTF) TO PRECHARGE
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
Tn
CK#
CK
Command 1
PRE
t WR2
Bank,
Col n
Add ress 3
Valid
t WPST
t WPRE
DQS, DQS #
DI
n
DQ4
DI
n+1
DI
n+2
DI
n+3
WL = 5
Indicates a Break In
Time Scale
Notes:
Transitioning Data
Don ’t Care
1. NOP commands are shown for ease of illustration; other commands may be valid at these
times.
2. The write recovery time ( t WR) is referenced from the rising clock edge at T9. t WR specifies
the last burst WRITE cycle until the PRECHARGE command can be issued to the same bank.
3. The BC4 setting is activated by MR0[1:0] = 01 and A12 = 0 during the WRITE command at T0.
4. DI n = data-in for column n.
5. BC4 (OTF), WL = 5, RL = 5.
DQ INPUT TIMING
)LJXUHVKRZVWKHVWUREHWRFORFNWLPLQJGXULQJD:5,7('46['46[?
PXVWWUDQVLWLRQZLWKLQt&.RIWKHFORFNWUDQVLWLRQVDVOLPLWHGE\tDQSS.
$OOGDWDDQGGDWDPDVNVHWXSDQGKROGWLPLQJVDUHPHDVXUHGUHODWLYHWRWKH
'46['46[?FURVVLQJVQRWWKHFORFNFURVVLQJ
PHPRU\FRQWUROOHUDIWHUWKHODVWGDWDLVZULWWHQWRWKH6'5$0GXULQJWKH
:5,7(SRVWDPEOHt:367
'DWDVHWXSDQGKROGWLPHVDUHVKRZQLQ)LJXUH$OOVHWXSDQGKROGWLPHV
DUHPHDVXUHGIURPWKHFURVVLQJSRLQWVRI'46[DQG'46[?7KHVHVHWXS
DQGKROGYDOXHVSHUWDLQWRGDWDLQSXWDQGGDWDPDVNLQSXW
7KH:5,7(SUHDPEOHDQGSRVWDPEOHDUHDOVRVKRZQ2QHFORFNSULRUWR
GDWDLQSXWWRWKH6'5$0'46[PXVWEH+,*+DQG'46[?PXVWEH/2:
7KHQIRUDKDOIFORFN'46[LVGULYHQ/2:'46[?LVGULYHQ+,*+GXULQJ
WKH:5,7(SUHDPEOH t:35(OLNHZLVH'46[PXVWEHNHSW/2:E\WKH
$GGLWLRQDOO\WKHKDOISHULRGRIWKHGDWDLQSXWVWUREHLVVSHFLILHGE\t'46+
and tDQSL.
FIGURE 86 - DATA INPUT TIMING
DQ S, DQS#
t WPRE
t DQSH
t WPST
t DQSL
DI
b
DQ
DM
t DS
t DH
Transitioning Data
LOGIC Devices Incorporated
www.logicdevices.com
132
Don ’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
PRECHARGE
,QSXW$GHWHUPLQHVZKHWKHURQHEDQNRUDOOEDQNVDUHWREH35(&+$5*('DQGLQWKHFDVHZKHUHRQO\RQHEDQNLVWREHSUHFKDUJHGLQSXWV%$>@VHOHFW
WKHDUUD\%$1.
:KHQDOOEDQNVDUHWREH35(&+$5*('LQSXWV%$>@DUHWUHDWHGDVv'RQuW&DUHw$IWHUDEDQNLV35(&+$5*('LWLVLQWKH,'/(6WDWHDQGPXVWEH
$&7,9$7('SULRUWRDQ\5($'RU:5,7(FRPPDQGVEHLQJLVVXHG
SELF REFRESH
7KH6(/)5()5(6+FRPPDQGLVLQLWLDWHGOLNHD5()5(6+FRPPDQGH[FHSW&.(LV/2:7KH'//LVDXWRPDWLFDOO\GLVDEOHGXSRQHQWHULQJ6(/)5()5(6+
DQGLVDXWRPDWLFDOO\HQDEOHGDQGUHVHWXSRQH[LWLQJ6(/)5()5(6+$OOSRZHUVXSSO\LQSXWVLQFOXGLQJ95()&$DQG95()'4PXVWEHPDLQWDLQHGDWYDOLG
OHYHOVXSRQHQWU\H[LWDQGGXULQJ6(/)5()5(6+PRGHRSHUDWLRQ95()'4PD\IORDWRUQRWGULYH9DD4ZKLOHLQWKH6(/)5()5(6+PRGHXQGHUFHUWDLQ
FRQGLWLRQV
x9VV95()'49DDLVPDLQWDLQHG
x95()'4LVYDOLGDQGVWDEOHSULRUWR&.(JRLQJEDFN+,*+
x7KHILUVW:5,7(RSHUDWLRQPD\QRWRFFXUHDUOLHUWKDQFORFNVDIWHU95()'4LVYDOLG
x$OORWKHU6(/)5()5(6+PRGHH[LWWLPLQJUHTXLUHPHQWVDUHPHW
7KH6'5$0PXVWEHLGOHZLWKDOO%$1.6LQWKH35(&+$5*(VWDWHt53LVVDWLVILHGDQGQREXUVWVDUHLQSURJUHVVEHIRUHD6(/)5()5(6+HQWU\FRPPDQG
FDQEHLVVXHG2'7PXVWDOVREHWXUQHGRIIEHIRUH6(/)5()5(6+HQWU\E\UHJLVWHULQJWKH2'7EDOO/2:SULRUWRWKH6(/)5()5(6+HQWU\FRPPDQGVHH
v2Q'LH7HUPLQDWLRQ2'7IRUWLPLQJUHTXLUHPHQWV,I5TT_NOM and RTTB:5DUHGLVDEOHGLQWKHPRGHUHJLVWHUV2'7FDQEHDv'RQuW&DUHw$IWHUWKH6(/)
5()5(6+HQWU\FRPPDQGLVUHJLVWHUHG&.(PXVWEHKHOG/2:WRNHHSWKH6'5$0LQ6(/)5()5(6+PRGH
$IWHUWKH6'5$0KDVHQWHUHG6(/)5()5(6+PRGHDOOH[WHUQDOFRQWUROVLJQDOVH[FHSW&.(DQG5(6(7?EHFRPHv'RQuW&DUHw7KH6'5$0LQLWLDWHVD
PLQLPXPRIRQH5()5(6+FRPPDQGLQWHUQDOO\ZLWKLQWKHt&.(SHULRGZKHQLWHQWHUV6(/)5()5(6+PRGH
7KHUHTXLUHPHQWVIRUHQWHULQJDQGH[LWLQJ6(/)5()5(6+PRGHGHSHQGRQWKHVWDWHRIWKHFORFNGXULQJ6(/)5()5(6+PRGH)LUVWDQGIRUHPRVWWKHFORFN
PXVWEHVWDEOHPHHWLQJt&.VSHFLILFDWLRQVZKHQ6(/)5()5(6+PRGHLVHQWHUHG,IWKHFORFNUHPDLQVVWDEOHDQGWKHIUHTXHQF\LQQRWDOWHUHGZKLOHLQ6(/)
5()5(6+PRGHWKHQWKH6'5$0LVDOORZHGWRH[LW6(/)5()5(6+DIWHUt&.(65LVVDWLVILHG&.(LVDOORZHGWRWUDQVLWLRQ+,*+ t&.(65ODWHUWKDQZKHQ
&.(ZDVUHJLVWHUHG/2:6LQFHWKHFORFNUHPDLQVVWDEOHLQ6(/)5()5(6+PRGHQRIUHTXHQF\FKDQJHt&.65(DQGt&.65;DUHQRWUHTXLUHG+RZHYHU
LIWKHFORFNLVDOWHUHGGXULQJ6(/)5()5(6+PRGHWKHQt&.65(DQGt&.65;PXVWEHVDWLVILHG:KHQHQWHULQJ6(/)5()5(6+t&.65(PXVWEHVDWLVILHG
SULRUWRDOWHULQJWKHFORFNuVIUHTXHQF\3ULRUWRH[LWLQJ6(/)5()5(6+t&.65;PXVWEHVDWLVILHGSULRUWRUHJLVWHULQJ&.(+,*+
:KHQ&.(LV+,*+GXULQJ6(/)5()5(6+H[LW123RU'(6PXVWEHLVVXHGIRUt;6WLPHt;6LVUHTXLUHGIRUWKHFRPSOHWLRQRIDQ\LQWHUQDO5()5(6+WKDW
LVDOUHDG\LQSURJUHVVDQGPXVWEHVDWLVILHGEHIRUHDYDOLGFRPPDQGQRWUHTXLULQJDORFNHG'//FDQEHLVVXHGWRWKHGHYLFHt;6LVDOVRWKHHDUOLHVWWLPHWKDWD
6(/)5()5(6+UHHQWU\PD\RFFXUVHH)LJXUH%HIRUHDFRPPDQGUHTXLULQJDORFNHG'//FDQEHDSSOLHGD=4&/FRPPDQGPXVWEHLVVXHGt=423(5
WLPLQJPXVWEHPHWDQGt;6'//PXVWEHVDWLVILHG2'7PXVWEHRIIGXULQJt;6'//
LOGIC Devices Incorporated
www.logicdevices.com
133
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 87 - SELF REFRESH ENTRY/EXIT TIMING
T0
T1
T2
Ta0
Tb0
Tc 0
Tc1
Td0
Te0
Tf0
Vali d
Vali d
CK#
CK
t CKSRX1
t CKSRE1
t IS
t IH
t CPDED
t IS
CKE
t CKESR (MIN)1
t IS
ODT2
Vali d
ODTL
RESET# 2
Command
SRE(REF)3
NOP
NOP 4
SRX (NOP)
NOP 5
Add ress
Vali d 6
Vali d 7
Vali d
Vali d
t XS 6 , 9
t RP 8
t XSDLL7, 9
Enter self refresh mode
(synchronous)
Exit self refresh mode
(asynchronous)
Indicates a Break in
Time Scale
Notes:
LOGIC Devices Incorporated
Don ’t Care
1. The clock must be valid and stable meeting t CK specifications at least t CKSRE after entering
self refresh mode, and at least t CKSRX prior to exiting self refresh mode, if the clock is
stopped or altered between states Ta0 and Tb0. If the clock remains valid and unchanged
from entry and during self refresh mode, then t CKSRE and t CKSRX do not apply; however,
t CKESR must be satisfied prior to exiting at SRX.
2. ODT must be disabled and R TT off prior to entering self re fresh at state T1. If both R TT_NOM
and RTT_WR are disabled in the mode registers, ODT can be a “Don’t Care.”
3. Self refresh entry (SRE) is synchronous via a REFRESH command with CKE LOW.
4. A NOP or DES command is required at T2 after the SRE command is issued prior to the
inputs becoming “Don’t Care.”
5. NOP or DES commands are required prior to exiting self refresh mode until state Te0.
6. t XS is required before any commands not requiring a locked DLL.
7. t XSDLL is required before any commands requiring a locked DLL.
8. The device must be in the all banks idle state prior to entering self refresh mode. For example, all banks must be precharged, t RP must be met, and no data bursts can be in progress.
9. Self refresh exit is asynchronous; however, t XS and t XSDLL timings start at the first rising
clock edge where CKE HIGH satisfies t ISXR at Tc1.t CKSRX timing is also measured so that
t ISXR is satisfied at Tc1.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
EXTENDED TEMPERATURE USAGE
/2*,&'HYLFHV,QFL02'''56'5$0PRGXOHVXSSRUWVWKHRSWLRQDOH[WHQGHGWHPSHUDWXUHUDQJHXSWRd“&ZKLOHVXSSRUWLQJ6(/)5()5(6+$872
5()5(6+DQGVXSSRUW7$WHPSHUDWXUHV!“&d“&ZLWK0$18$/5()5(6+RQO\:KHQXVLQJ6(/)5()5(6+$8725()5(6+DQGWKHDPELHQW
WHPSHUDWXUHLV!“&657DQG$65RSWLRQVPXVWEHXVHG
7KHH[WHQGHGUDQJHWHPSHUDWXUHUDQJH6'5$0PXVWEH5()5(6+('H[WHUQDOO\DW;DQ\WLPHWKHDPELHQWWHPSHUDWXUHLV!“&7KHH[WHUQDO5()5(6+,1*UHTXLUHPHQWLVDFFRPSOLVKHGE\UHGXFLQJWKH5()5(6+3(5,2'IURPPVWRPV6(/)5()5(6+PRGHUHTXLUHVWKHXVHRI$65RU657WRVXSSRUW
WKHH[WHQGHGWHPSHUDWXUH
TABLE 63: SELF REFRESH TEMPERATURE AND AUTO SELF REFRESH DESCRIPTION
Field
MR2 Bits
6HOI5HIUHVK7HPSHUDWXUH657
SRT
Description
,I$65LVGLVDEOHG05>@ 657PXVWEHSURJUDPPHGWRLQGLFDWHt23(5GXULQJ6(/)5()5(6+
05>@ 1RUPDORSHUDWLQJWHPSHUDWXUHUDQJH“&WRd 85“&
05>@ ([WHQGHGRSHUDWLQJWHPSHUDWXUHUDQJH!“&WRd 105“&
,I$65LVHQDEOHG05>@ 657PXVWEHVHWWRHYHQLIWKHH[WHQGHGWHPSHUDWXUHUDQJHLVVXSSRUWHG
05>@ 657LVGLVDEOHG
$XWR6HOI5HIUHVK$65
6
ASR
:KHQ$65LVHQDEOHGWKH6'5$0DXWRPDWLFDOO\SURYLGHV6(/)5()5(6+SRZHUPDQDJHPHQWIXQFWLRQVUHIUHVKUDWH
IRUDOOVXSSRUWHGRSHUDWLQJWHPSHUDWXUHYDOXHV
05>@ $65LVHQDEOHG0PXVW :KHQ$65LVQRWHQDEOHGWKH657ELWPXVWEHSURJUDPPHGWRLQGLFDWHt23(5GXULQJ6(/)5()5(6+RSHUDWLRQ
05>@ $65LVGLVDEOHGPXVWXVHPDQXDO6(/)5()5(6+657
TABLE 64: SELF REFRESH MODE SUMMARY
MR2[6]
(ASR)
0
0
MR2[7]
(SRT)
Permitted Operating Temperature
Range for Self Refresh Mode
SELF REFRESH Operation
0
6(/)5()5(6+0RGHLVVXSSRUWHGLQWKHQRUPDOWHPSHUDWXUHUDQJH
1RUPDO“&WR“&
1
6(/)5()5(6+0RGHLVVXSSRUWHGLQQRUPDODQGH[WHQGHGd 95“&0$;
1RUPDODQGH[WHQGHG“&WR“&
WHPSHUDWXUHUDQJHV:KHQ657LVHQDEOHGLWLQFUHDVHVVHOIUHIUHVKSRZHU
FRQVXPSWLRQ
1
0
6HOIUHIUHVKPRGHLVVXSSRUWHGLQQRUPDODQGH[WHQGHGWHPSHUDWXUHUDQJHV
1RUPDODQGH[WHQGHG“&WR“&
6HOIUHIUHVKSRZHUFRQVXPSWLRQPD\EHWHPSHUDWXUHGHSHQGHQW
1
1
Illegal.
POWER-DOWN MODE
3RZHUGRZQLVV\QFKURQRXVO\HQWHUHGZKHQ&.(LVUHJLVWHUHG/2:FRLQFLGHQWZLWKD123RU'(6FRPPDQG&.(LVQRWDOORZHGWRJR/2:ZKLOHHLWKHUDQ
056035=4&$/5($'RU:5,7(RSHUDWLRQLVLQSURJUHVV&.(LVDOORZHGWRJR/2:ZKLOHDQ\RIWKHRWKHUOHJDORSHUDWLRQVDUHLQSURJUHVV+RZHYHUWKH
32:(5'2:1,DDVSHFLILFDWLRQVDUHQRWDSSOLFDEOHXQWLOVXFKRSHUDWLRQVKDYHEHHQFRPSOHWHG'HSHQGLQJRQWKHSUHYLRXV6'5$0VWDWHDQGWKHFRPPDQG
LVVXHGSULRUWR&.(JRLQJ/2:FHUWDLQWLPLQJFRQVWUDLQWVPXVWEHVDWLVILHGDVQRWHGLQ7DEOH7LPLQJGLDJUDPVGHWDLOLQJWKHGLIIHUHQW32:(5'2:1
PRGHHQWU\DQGH[LWVDUHVKRZQLQ)LJXUHWKURXJK)LJXUH
LOGIC Devices Incorporated
www.logicdevices.com
135
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 65: COMMAND TO POWER-DOWN ENTRY PARAMETERS
Last Command prior
to CKE Low 1
Parameter (MIN)
Parameter Value
Figure
Idle or Active
$&7,9$7(
t$&73'(1
1t&.
Figure 95
Idle or Active
35(&+$5*(
t353'(1
1t&.
Figure 96
5($'RU5($'$3
t5'3'(1
5/ t&.t&.
Figure 91
:5,7(%/27)%/056%&27)
t:53'(1
:/t&.t:5t&.
Figure 92
:/t&.t:5t&.
Figure 92
:/t&.:5t&.
Figure 93
:/t&.:5t&.
Figure 93
5()5(6+
t5()3'(1
1t&.
)LJXUH
5()5(6+
t;3'//
*UHDWHURIt&.RUQV
Figure 98
02'(5(*,67(56(7
t0563'(1
tMOD
)LJXUH
SDRAM
Status
Active
Active
:5,7(%&056
Active
:5,7($3%/27)%/056%&27)
Active
t:5$3'(1
:5,7($3%&056
Active
Idle
POWER-DOWN
Idle
(QWHULQJ32:(5'2:1PRGHGLVDEOHVWKHLQSXWDQGRXWSXWEXIIHUVH[FOXGLQJ&.&.?2'7&.(DQG5(6(7?123RU'(6FRPPDQGVDUHUHTXLUHGXQWLO
t&3'('KDVEHHQVDWLVILHGDWZKLFKWLPHDOOVSHFLILHGLQSXWRXWSXWEXIIHUVZLOOEHGLVDEOHG7KH'//VKRXOGEHLQDORFNHGVWDWHZKHQ32:(5'2:1LV
HQWHUHGIRUWKHIDVWHVWPRGHWLPLQJ,IWKH'//LVQRWORFNHGGXULQJWKH32:(5'2:1HQWU\WKH'//PXVWEHUHVHWDIWHUH[LWLQJ32:(5'2:1IRUSURSHU
5($'RSHUDWLRQDVZHOODVV\QFKURQRXV2'7RSHUDWLRQ
'XULQJ32:(5'2:1HQWU\LIDQ\EDQNUHPDLQVRSHQDIWHUDOOLQSURJUHVVFRPPDQGVDUHFRPSOHWHWKH6'5$0ZLOOEHLQ$&7,9(32:(5'2:1,IDOO
EDQNVDUHFORVHGDIWHUDOOLQSURJUHVVFRPPDQGVDUHFRPSOHWHWKH6'5$0ZLOOEHLQ35(&+$5*(32:(5'2:1PRGHRUIDVW(;,7PRGH:KHQHQWHULQJ
35(&+$5*(32:(5'2:1WKH'//LVWXUQHGRIILQVORZH[LWPRGHRUNHSWRQLQIDVW(;,7PRGH
7KH'//UHPDLQVRQZKHQHQWHULQJ$&7,9(32:(5'2:1DVZHOO2'7KDVVSHFLDOWLPLQJFRQVWUDLQWVZKHQVORZ(;,7PRGH35(&+$5*(32:(5
'2:1LVHQDEOHGDQGHQWHUHG5HIHUWRv$V\QFKURQRXV2'70RGHwIRUGHWDLOHG2'7XVDJHUHTXLUHPHQWVLQVORZ(;,7PRGH35(&+$5*(32:(5'2:1
$VXPPDU\RIWKHWZR32:(5'2:1PRGHVLVOLVWHGLQ7DEOH
:KLOHLQHLWKHU32:(5'2:1VWDWH&.(LVKHOG/2:5(6(7?LVKHOG+,*+DQGDVWDEOHFORFNVLJQDOPXVWEHPDLQWDLQHG2'7PXVWEHLQDYDOLGVWDWHEXW
DOORWKHULQSXWVLJQDOVDUHDv'RQuW&DUHw,I5(6(7?JRHV/2:GXULQJ32:(5'2:1WKH6'5$0ZLOOVZLWFKRXWRI32:(5'2:1DQGJRLQWRWKH5(6(7
VWDWH$IWHU&.(LVUHJLVWHUHG/2:&.(PXVWUHPDLQ/2:XQWLO t3'0,1KDVEHHQVDWLVILHG7KHPD[LPXPWLPHDOORZHGIRU32:(5'2:1GXUDWLRQLV
t3'0$;[W5(),
7KH32:(5'2:1VWDWHVDUHV\QFKURQRXVO\H[LWHGZKHQ&.(LVUHJLVWHUHG+,*+ZLWKDUHTXLUHG123RU'(6FRPPDQG&.(PXVWEHPDLQWDLQHG+,*+
until t&.(KDVEHHQVDWLVILHG$YDOLGH[HFXWDEOHFRPPDQGPD\EHDSSOLHGDIWHU32:(5'2:1(;,7/$7(1&<t;3t;3'//KDYHEHHQVDWLVILHG$VXPPDU\RIWKH32:(5'2:1PRGHVLVOLVWHGLQ7DEOH
TABLE 66: POWER-DOWN MODES
MR1[12]
DLL State
POWER-DOWN
exit
v'RQuW&DUHw
ON
)$67
t;3WRDQ\RWKHUYDOLG&200$1'
1
ON
)$67
t;3WRDQ\RWKHUYDOLG&200$1'
0
OFF
6/2:
SDRAM State
$&7,9(DQ\EDQNRSHQ
35(&+$5*(DOOEDQNV35(&+$5*('
Relevant Parameters
t;'//WR&200$1'6WKDWUHTXLUHWKH'//
WREHORFNHG5($'5'$32'721
t;3WRDQ\RWKHUYDOLG&200$1'
LOGIC Devices Incorporated
www.logicdevices.com
136
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 88 - ACTIVE POWER-DOWN ENTRY AND EXIT
T0
T1
T2
Ta0
Ta1
Ta2
Ta3
Ta4
NOP
NOP
NOP
Valid
CK#
CK
Command
t CK
t CH
t CL
NOP
Valid
NOP
t PD
t IS
CKE
Address
t IH
t IS
t IH
t CKE (MIN)
Valid
Valid
t CPDED
t XP
Enter power-down
mode
Exit power-down
mode
Indicates a Break in
Time Scale
Don’t Care
FIGURE 89 - PRECHARGE POWER-DOWN (FAST-EXIT MODE) ENTRY AND EXIT
T0
T1
T2
T3
T4
T5
NOP
NOP
Ta0
Ta1
NOP
Valid
CK#
CK
Co m m an d
t CK
t CH
t CL
NOP
NOP
t CPDED
t CKE (MIN)
t IH
t IS
tCKEmin
CKE
tCKEmin
t IS
t XP
t PD
Enter power-down
mode
Exit power-down
mode
Indicates a Break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
Don’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 90 - PRECHARGE POWER-DOWN (SLOW-EXIT MODE) ENTRY AND EXIT
T0
T1
T2
T3
T4
Ta
Ta1
NOP
NOP
Tb
CK#
CK
t CK
Command
t CH
t CL
NOP
PRE
NOP
Valid 1
Valid 2
t CKE (MIN)
t CPDED
t XP
t IS
t IH
CKE
t IS
t XPDLL
t PD
Enter power-down
mode
Exit power-down
mode
Indicates a Break in
Time Scale
Notes:
Don’t Care
1. Any valid command not requiring a locked DLL.
2. Any valid command requiring a locked DLL.
FIGURE 91 - POWER-DOWN ENTRY AFTER READ OR READ WITH AUTO PRECHARGE (RDAP)
CK#
T0
T1
Ta0
Ta1
Ta2
Ta3
Ta4
Ta5
Ta6
READ/
RDAP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
Ta7
Ta8
Ta9
Ta10
Ta11
Ta12
CK
Command
NOP
t IS
NOP
t CPDED
CKE
Add ress
Vali d
t PD
RL = AL + CL
DQS, DQS#
DQ BL8
DQ BC4
DI
n
DI
DI
n+1 n+2
DI
n+3
DI
n
DI
n+1
DI
n+3
DI
n+2
DI
n+4
DI
n+ 5
DI
n+6
DI
n+7
t RDPDEN
Power- down or
self refresh entry
Indicates a break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
138
Transitioning Data
Don ’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 92 - POWER-DOWN ENTRY AFTER WRITE
CK#
T0
T1
Ta0
Ta1
Ta2
Ta3
Ta4
Ta5
Ta6
Ta7
Tb0
WRITE
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
Tb1
Tb2
Tb3
Tb4
CK
Command
NOP
t IS
NOP
t CPDED
CKE
Add ress
Valid
t WR
WL = AL + CWL
t PD
DQS, DQS#
DQ BL8
DI
n
DI
DI
n+1 n+2
DI
n+3
DQ BC4
DI
n
DI
n+1
DI
n+3
DI
n+2
DI
n+4
DI
n+5
DI
n+6
DI
n+7
t WRPDEN
Power- down or
self refresh entry 1
Indicates A Break in
Time Scale
Transitioning Data
Don ’t Care
1. CKE can go LOW 2 tCK earlier if BC4MRS.
Notes:
FIGURE 93 - POWER-DOWN ENTRY AFTER WRITE WITH AUTO PRECHARGE (WRAP)
CK#
T0
T1
Ta0
Ta1
Ta2
Ta3
Ta4
Ta5
Ta6
Ta7
Tb0
Tb1
Tb2
WRAP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
Tb3
Tb4
CK
Command
t IS
t CPDED
CKE
Add ress
Vali d
A10
WR1
WL = AL + CWL
t PD
DQS, DQS#
DQ BL8
DI
n
DI
n+1
DI
n+2
DI
DI
n+3 n+4
DQ BC4
DI
n
DI
n+1
DI
n+2
DI
n+3
DI
n+5
DI
n+6
DI
n+7
t WRAPDEN
Start internal
pre char ge
Power- down or
self refresh entry 2
Indicates a Break in
Time Scale
Notes:
LOGIC Devices Incorporated
Transitioning Data
Don ’t Care
is programmed through MR0[11:9] and represents t WR (MIN)ns/ t CK rounded up to the
next integer t CK.
2. CKE can go LOW 2 tCK earlier if BC4MRS.
1.
t WR
www.logicdevices.com
139
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 94 - REFRESH TO POWER-DOWN ENTRY
T0
T1
T2
T3
NOP
NOP
Ta0
Ta1
Ta2
Tb0
NOP
NOP
Valid
CK#
CK
t CK
Command
t CH
t CL
REFRESH
t CPDED
t CKE (MIN)
t PD
t IS
CKE
t XP (MIN)
t REFPDEN
t RFC (MIN)1
Indicates a Break In
Time Scale
Notes:
Don’t Care
1. After CKE goes HIGH during t RFC, CKE must remain HIGH until t RFC is satisfied.
FIGURE 95 - ACTIVATE TO POWER-DOWN ENTRY
T0
T1
T2
T3
T4
T5
T6
T7
CK#
CK
Command
Address
t CK
t CH
t CL
ACTIVE
NOP
NOP
Valid
t CPDED
t IS
t PD
CKE
t ACTPDEN
tCKE
Don’t Care
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 96 - PRECHARGE TO POWER-DOWN ENTRY
T0
T1
T2
T3
NOP
NOP
T4
T5
T6
T7
CK#
CK
t CK
Command
t CH
t CL
PRE
All/single
bank
Address
t CPDED
t IS
t PD
CKE
t PREPDEN
Don’t Care
FIGURE 97 - MRS COMMAND TO POWER-DOWN ENTRY
T0
T1
T2
Ta0
Ta1
Ta2
Ta3
Ta4
CK#
CK
t CK
Command
MRS
Address
Valid
t CH
NOP
t CL
t CPDED
NOP
NOP
NOP
NOP
t PD
t MRSPDEN
t IS
CKE
Indicates a Break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
Don’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 98 - POWER-DOWN EXIT TO REFRESH TO POWER-DOWN ENTRY
T0
T1
T2
T3
T4
Ta0
Ta1
Tb0
NOP
REFRESH
NOP
NOP
CK#
CK
Command
t CK
NOP
t CH
t CL
NOP
NOP
t CPDED
t XP1
t IH
t IS
CKE
t IS
t PD
t XPDLL2
Enter power-down
mode
Exit power-down
mode
Enter power-down
mode
Indicates a Break in
Time Scale
Notes:
Don’t Care
1. t XP must be satisfied before issuing the command.
2. t XPDLL must be satisfied (referenced to the registration of power-down exit) before the
next power-down can be entered.
RESET
7KH5(6(7VLJQDO5(6(7?LVDQDV\QFKURQRXVVLJQDOWKDWWULJJHUVDQ\WLPHLWGURSV/2:DQGWKHUHDUHQRUHVWULFWLRQVDERXWZKHQLWFDQJR/2:$IWHU
5(6(7?LVGULYHQ/2:LWPXVWUHPDLQ/2:IRUQV'XULQJWKLVWLPHWKHRXWSXWVDUHGLVDEOHG2'75TTWXUQVRII+,*+=DQGWKH''56'5$0UHVHWV
LWVHOI&.(VKRXOGEHEURXJKW/2:SULRUWR5(6(7?EHLQJGULYHQ+,*+$IWHU5(6(7?JRHV+,*+WKH6'5$0PXVWEHUHLQLWLDOL]HGDVWKRXJKDQRUPDO
SRZHUXSZHUHH[HFXWHGVHH)LJXUH$OOUHIUHVKFRXQWHUVRQWKH6'5$0DUH5(6(7DQGGDWDVWRUHGLQWKH6'5$0LVDVVXPHGXQNQRZQDIWHU5(6(7?
KDVEHHQGULYHQ/2:
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 99 - RESET SEQUENCE
System RESET
(warm boot)
Sta ble an d
vali d clo ck
T1
T0
Tc0
Tb0
Ta0
t CK
Td0
CK#
CK
t CL
t CL
T (MIN) =
MAX (10ns, 5 t CK)
T = 100ns (MIN)
RESET#
t IOZ
T=10ns (MIN)
t IS
Vali d
CKE
ODT
Vali d
Vali d
Vali d
Vali d
ZQ CL
Vali d
t IS
MRS
MRS
MRS
MRS
Add ress
Code
Code
Code
Code
A10
Code
Code
Code
Code
BA0 = L
BA1 = H
BA2 = L
BA0 = H
BA1 = H
BA2 = L
BA0 = H
BA1 = L
BA2 = L
BA0 = L
BA1 = L
BA2 = L
Command
NOP
DM
BA[2:0]
DQS
DQ
RTT
A10 = H
Vali d
Vali d
High-Z
High-Z
High-Z
t MRD
t MRD
t XPR
T = 500μs (MIN)
MR2
All voltage
supplies valid
and stable
Vali d
MR3
DRAM rea dy
for external
commands
t MRD
MR1 with
DLL ENABLE
t MOD
MR0 with
DLL RESET
ZQ CAL
t ZQ INIT
t DLLK
Normal
operation
Indicates a Break in
Time Scale
LOGIC Devices Incorporated
www.logicdevices.com
Don ’t Care
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ON-DIE TERMINATION (ODT)
FUNCTIONAL REPRESENTATION OF ODT
2'7LVDIHDWXUHWKDWHQDEOHVWKH6'5$0WRHQDEOHGLVDEOHRQGLHWHUPLQDWLRQUHVLVWDQFHIRUHDFK'4/'46[/'46[?8'46[8'46[?/'0[DQG
8'0[IRUWKHIRXUZRUGVFRQWDLQHGLQ/',uV''5L02'
7KHYDOXHRI5TT2'7WHUPLQDWLRQYDOXHLVGHWHUPLQHGE\WKHVHWWLQJVRI
VHYHUDOPRGHUHJLVWHUELWVVHH7DEOH7KH2'7EDOOLVLJQRUHGZKLOH
LQ 6(/) 5()5(6+ PRGH PXVW EH WXUQHG RII SULRU WR 6(/) 5()5(6+
HQWU\RULIPRGHUHJLVWHUV05DQG05DUHSURJUDPPHGWRGLVDEOH2'7
2'7LVFRPSULVHGRIQRPLQDO2'7DQGG\QDPLF2'7PRGHVDQGHLWKHURI
WKHVHFDQIXQFWLRQLQV\QFKURQRXVRUDV\QFKURQRXVPRGHVZKHQWKH'//
LVRIIGXULQJ35(&+$5*(32:(5'2:1RUZKHQWKH'//LVV\QFKURQL]LQJ 1RPLQDO 2'7 LV WKH EDVH WHUPLQDWLRQ DQG LV XVHG LQ DQ\ DOORZDEOH
2'7VWDWH'\QDPLF2'7LVDSSOLHGRQO\GXULQJ:5,7(VDQGSURYLGHV27)
VZLWFKLQJIURPQR5TT or RTT_NOM to RTTB:5
7KH 2'7 IHDWXUH LV GHVLJQHG WR LPSURYH VLJQDO LQWHJULW\ RI WKH PHPRU\
DUUD\VXEV\VWHP E\ HQDEOLQJ WKH ''5 PHPRU\ FRQWUROOHU WR LQGHSHQGHQWO\ WXUQ RQ RU RII WKH 6'5$06 LQWHUQDO WHUPLQDWLRQ UHVLVWDQFH IRU DQ\
JURXSLQJRI6'5$0GHYLFHV7KH2'7IHDWXUHLVQRWVXSSRUWHGGXULQJ'//
GLVDEOHPRGH$VLPSOHIXQFWLRQDOUHSUHVHQWDWLRQRIWKH6'5$02'7IHDWXUHLVVKRZQLQ)LJXUH7KHVZLWFKLVHQDEOHGE\WKHLQWHUQDO2'7FRQWUROORJLFZKLFKXVHVWKHH[WHUQDO2'7EDOODQGRWKHUFRQWUROLQIRUPDWLRQ
7KH DFWXDO HIIHFWLYH WHUPLQDWLRQ 5TTB()) PD\ EH GLIIHUHQW IURP WKH 5TT
WDUJHWHGGXHWRQRQOLQHDULW\RIWKHWHUPLQDWLRQ)RU5TTB())YDOXHVDQG
FDOFXODWLRQVVHHv2'7&KDUDFWHULVWLFVw
FIGURE 100 - ON-DIE TERMINATION
NOMINAL ODT
2'7 120 LV WKH EDVH WHUPLQDWLRQ UHVLVWDQFH IRU HDFK DSSOLFDEOH EDOO
HQDEOHGRUGLVDEOHGYLD05>@VHH)LJXUHDQGLWLVWXUQHGRQRU
RIIYLDWKH2'7EDOO
ODT
To other
circuitry
such as
RCV,
...
VDDQ/2
RTT
Switch
DQ, DQS, DQS#,
DM
TABLE 67: POWER-DOWN MODES
MR1[9,6,2]
SDRAM Termination State
SDRAM State
Notes
000
ODT Pin
0
RTTB120GLVDEOHG2'72))
$Q\YDOLG
1,2
000
1
RTTB120GLVDEOHG2'721
$Q\YDOLGH[FHSW6(/)5()5(6+5($'
1,3
000-101
0
RTTB120HQDEOHG2'72))
$Q\YDOLG
1,2
000-101
1
RTTB120HQDEOHG2'721
$Q\YDOLGH[FHSW6(/)5()5(6+5($'
1,3
110 and 111
;
RTTB120UHVHUYHG2'721RU2))
Illegal
127(6
1.
$VVXPHVG\QDPLF2'7LVGLVDEOHG
2.
2'7LVHQDEOHGDQGDFWLYHGXULQJPRVW:5,7(6IRUSURSHUWHUPLQDWLRQ
3.
2'7PXVWEHGLVDEOHGGXULQJ5($'V7KHRTTB120YDOXHLVUHVWULFWHG
GXULQJ:5,7(6'\QDPLF2'7LVDSSOLFDEOHLIHQDEOHG
EXWLWLVQRWLOOHJDOWRKDYHLWRIIGXULQJ:5,7(6
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
NOMINAL ODT
1RPLQDO2'7UHVLVWDQFH5TTB120LVGHILQHGE\05>@DVVKRZQLQ)LJXUH7KH5TTB120WHUPLQDWLRQYDOXHDSSOLHVWRWKHRXWSXWSLQVSUHYLRXVO\
PHQWLRQHG''56'5$0L02'VVXSSRUWPXOWLSOH5TTB120YDOXHVEDVHGRQ5=4QZKHUHQFDQEHRUDQG5=4LV:”5TTB120WHUPLQDWLRQLVDOORZHGDQ\WLPHDIWHUWKH6'5$0LVLQLWLDOL]HGFDOLEUDWHGDQGQRWSHUIRUPLQJ5($'DFFHVVHVRUZKHQLWLVQRWLQ6(/)5()5(6+PRGH
:5,7(DFFHVVXVHV5TTB120LGG\QDPLF2'75TTB:5LVGLVDEOHG,I5TTB120LVXVHGGXULQJ:5,7(VRQO\5=45=4DQG5=4DUHDOORZHGVHH
7DEOH2'7WLPLQJVDUHVXPPDUL]HGLQ7DEOHDVZHOODVOLVWHGLQ7DEOH
([DPSOHVRIQRPLQDO2'7WLPLQJDUHVKRZQLQFRQMXQFWLRQZLWKWKHV\QFKURQRXVPRGHRIRSHUDWLRQLQv6\QFKURQRXV2'70RGHw
TABLE 68: ODT PARAMETER
Begins at
Defined to
Definition for
All DDR3 bins
Units
ODTL ON
2'7V\QFKURQRXVWXUQRQGHOD\
2'7UHJLVWHUHG+,*+
RTTB21”t$21
&:/$/
t&.
ODTL OFF
2'7V\QFKURQRXVWXUQRIIGHOD\
2'7UHJLVWHUHG+,*+
RTTB21”t$2)
&:/$/
t&.
t$213'
2'7DV\QFKURQRXVRQGHOD\
2'7UHJLVWHUHG+,*+
RTT_ON
1-9
QV
t$2))3'
2'7DV\QFKURQRXVRQGHOD\
2'7UHJLVWHUHG+,*+
RTT_OFF
1-9
QV
2'7UHJLVWHUHG/2:
t&.
t&.
t&.
Symbol
Description
2'7UHJLVWHUHG+,*+RU:5,7(
2'7+
2'7PLQLPXP+,*+WLPHDIWHU2'7DVVHUWLRQ
RU:5,7(%&
UHJLVWUDWLRQZLWK2'7+,*+
2'7+
2'7PLQLPXP+,*+WLPHDIWHU:5,7(%/
:5,7(UHJLVWUDWLRQZLWK2'7+,*+
2'7UHJLVWHUHG/2:
6t&.
t$21
2'7WXUQRQUHODWLYHWR2'7/RQFRPSOHWLRQ
&RPSOHWLRQRI2'7/RQ
RTT_ON
6HH7DEOH
SV
0.5t&.”t&.
t&.
t$2)
2'7WXUQRIIUHODWLYHWR2'7/RIIFRPSOHWLRQ
&RPSOHWLRQRI2'7/RII
RTT_OFF
DYNAMIC ODT
,QFHUWDLQDSSOLFDWLRQVWRIXUWKHUHQKDQFHVLJQDOLQWHJULW\RQWKHGDWDEXVLWLVGHVLUDEOHWKDWWKHWHUPLQDWLRQVWUHQJWKEHFKDQJHGZLWKRXWLVVXLQJDQ056
FRPPDQGHVVHQWLDOO\FKDQJLQJWKH2'7WHUPLQDWLRQUHVLVWDQFHRQWKHIO\:LWKG\QDPLF2'75TTB:5HQDEOHGWKH6'5$0VZLWFKHVIURPQRPLQDO2'7
5TTB120WRG\QDPLF2'7ZKHQEHJLQQLQJD:5,7(EXUVWDQGVXEVHTXHQWO\VZLWFKHVEDFNWRQRPLQDO2'7DWWKHFRPSOHWLRQRIWKH:5,7(EXUVWVHTXHQFH
7KLVUHTXLUHPHQWDQGWKHVXSSRUWLQJ'<1$0,&2'7IHDWXUHRIWKH''56'5$0PDNHVLWIHDVLEOHDQGLVGHVFULEHGLQIXUWKHUGHWDLOEHORZ
DYNAMIC ODT FUNCTIONAL DESCRIPTION:
7KHG\QDPLF2'7PRGHLVHQDEOHGLIHLWKHU05>@RUP5>@LVVHWWRvw'\QDPLF2'7LVQRWVXSSRUWHGGXULQJ'//GLVDEOHPRGHVR5TTB:5PXVWEH
GLVDEOHG7KHG\QDPLF2'7IXQFWLRQLVGHVFULEHGDVIROORZV
x7ZR5TTYDOXHVDUHDYDLODEOHy5TT_NOM and RTTB:5
x7KHYDOXHRI5TTB120LVSUHVHOHFWHGYLD05>@
x7KHYDOXHIRU5TTB:5LVSUHVHOHFWHGYLD05>@
x'XULQJ6'5$0RSHUDWLRQVZLWKRXW5($'RU:5,7(FRPPDQGVWKHWHUPLQDWLRQLVFRQWUROOHGDVIROORZV
x7HUPLQDWLRQ212))WLPLQJLVFRQWUROOHGYLDWKH2'7EDOODQG/$7(1&,(62'7ORQDQG2'7/RII
x1RPLQDOWHUPLQDWLRQVWUHQJWK5TTB120LVXVHG
x:KHQD:5,7(FRPPDQG:5:5$3:56:56:5$36:5$36LVUHJLVWHUHGDQGLIG\QDPLF2'7LVHQDEOHGWKH2'7WHUPLQDWLRQLVFRQWUROOHGDVIROORZV
x$ODWHQF\RI2'7/&1:DIWHUWKH:5,7(FRPPDQGWHUPLQDWLRQVWUHQJWK5TTB120VZLWFKHVWR5TTB:5
x$/DWHQF\RI2'7/&:1IRU%/IL[HGRU27)RU2'7/&:1IRU%&IL[HGRU27)DIWHUWKH:5,7(FRPPDQGWHUPLQDWLRQ
VWUHQJWK5TTB:5VZLWFKHVEDFNWR5TT_NOM
x212))WHUPLQDWLRQWLPLQJLVFRQWUROOHGYLDWKH2'7EDOODQGGHWHUPLQHGE\2'7/RQ2'7/RII2'7+DQG2'7+
xDuring the t$'&WUDQVLWLRQZLQGRZWKHYDOXHRI5TTLVXQGHILQHG
2'7LVFRQVWUDLQHGGXULQJ:5,7(VDQGZKHQG\QDPLF2'7LVHQDEOHGVHH7DEOH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
TABLE 69: DYNAMIC ODT SPECIFIC PARAMETERS
Symbol
Description
Begins at
Defined to
Definition for
All DDR3 bins
Units
ODTL&1:
&KDQJHIURP5TT_NOM to RTTB:5
:5,7(UHJLVWUDWLRQ
RTTVZLWFKHGIURP5TT_NOM to RTTB:5
:/
t&.
ODTL&:1
&KDQJHIURP5TTB:5WR5TTB120%&
:5,7(UHJLVWUDWLRQ
RTTVZLWFKHGIURP5TTB:5WR5TT_NOM
t&.2'7/2))
t&.
t&.
t&.
ODTL&:1
&KDQJHIURP5TTB:5WR5TTB120%/
:5,7(UHJLVWUDWLRQ
RTTVZLWFKHGIURP5TTB:5WR5TT_NOM
6t&.2'7/2))
t$'&
RTTFKDQJHVNHZ
ODTL&1:
RTTWUDQVFRPSOHWH
0.5t&.”t&.
TABLE 70: MODE REGISTERS FOR RTT_NOM
M9
MR1(RTT_NOM)
M6
0
0
0
0
0
0
M2
RTT_NOM (RZQ)
RTT_NOM(Ohms)
RTT_NOM Mode Restriction
0
2II
2II
QD
1
5=4
60
6(/)5()5(6+
1
0
5=4
120
1
1
5=4
1
0
0
5=4
20
1
0
1
5=4
30
1
1
0
5HVHUYHG
5HVHUYHG
QD
1
1
1
5HVHUYHG
5HVHUYHG
QD
6(/)5()5(6+:5,7(
TABLE 71: MODE REGISTERS FOR RTT_WR
MR1(RTT_NOM)
M10
M2
0
0
0
1
1
0
5=4
120
1
1
5HVHUYHG
5HVHUYHG
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
QD
RTT_NOM (RZQ)
RTT_NOM(Ohms)
Dynamic ODT OFF: WRITE does not affect RTT_NOM
60
5=4
TABLE 72: TIMING DIAGRAMS FOR DYNAMIC ODT
Figure
Title
'\QDPLF2'72'7DVVHUWHGEHIRUHDQGDIWHUWKH:5,7(%&
Figure 101
Figure 102
'\QDPLF2'7:LWKRXW:5,7(FRPPDQG
Figure 103
'\QDPLF2'72'7SLQDVVHUWHGWRJHWKHUZLWK:5,7(FRPPDQGIRU&.F\FOHV%/
)LJXUH
'\QDPLF2'72'7SLQDVVHUWHGZLWK:5,7(FRPPDQGIRU&.F\FOHV%&
Figure 105
'\QDPLF2'72'7SLQDVVHUWHGZLWK:5,7(FRPPDQGIRU&.F\FOHV%&
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
L9D3256M32DBG2
L9D3512M32DBG2
PRELIMINARY INFORMATION
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 101 - DYNAMIC ODT: ODT ASSERTED BEFORE AND AFTER THE WRITE, BC4
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
T10
T11
T12
T13
T14
T15
T16
T17
NOP
NOP
NOP
NOP
WRS4
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
Add ress
Vali d
ODTH4
ODTL off
ODTH4
ODT
ODTLCWN 4
ODTL on
t ADC (MIN)
t AON (MIN)
RTT
RTT_NOM
t AON (MAX)
t ADC (MIN)
t AOF (MIN)
RTT_WR
RTT_NOM
t AOF (MAX)
t ADC (MAX)
t ADC (MAX)
ODTLCNW
DQS, DQS#
DQ
DI
n
WL
DI
n +1
DI
n +2
DI
n +3
Transitioning
Notes:
Don ’t Care
1. Via MRS or OTF. AL = 0, CWL = 5. RTT_NOM and RTT_WR are enabled.
2. ODTH4 applies to first registering ODT HIGH and then to the registration of the WRITE command. In this example,
ODTH4 is satisfied if ODT goes LOW at T8 (four clocks after the WRITE command).
FIGURE 102 - DYNAMIC ODT: WITHOUT WRITE COMMAND
CK#
CK
Command
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
T10
T11
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Vali d
Add ress
ODTH4
ODTL on
ODTL off
ODT
t AON (MAX)
t AOF (MIN)
RTT_NOM
RTT
t AOF (MAX)
t AON (MIN)
DQS, DQS#
DQ
Transitionin g
Notes:
LOGIC Devices Incorporated
Don ’t Care
1. AL = 0, CWL = 5. RTT_NOM is enabled and R TT_WR is either enabled or disabled.
2. ODTH4 is defined from ODT registered HIGH to ODT registered LOW; in this example,
ODTH4 is satisfied. ODT registered LOW at T5 is also legal.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 103 - DYNAMIC ODT: ODT PIN ASSERTED TOGETHER WITH WRITE COMMAND FOR 6 CLOCK CYCLES, BL8
T0
T1
T2
NOP
WRS8
NOP
T3
T4
T5
T6
T7
T8
T9
T10
T11
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
ODTLCNW
Vali d
Add ress
ODTH8
ODTLOFF
ODTLON
ODT
t ADC (MAX)
t AOF (MIN)
RTT_WR
RTT
t AON (MIN)
t AOF (MAX)
ODTLCWN 8
DQS, DQS#
WL
DI
b
DQ
DI
b+1
DI
b+2
DI
b+3
DI
b+4
DI
b+5
DI
b+7
DI
b+6
Transitioning
Notes:
Don ’t Care
1. Via MRS or OTF; AL = 0, CWL = 5. If RTT_NOM can be either enabled or disabled, ODT can be HIGH. RTT_WR is enabled.
2. In this example, ODTH8 = 6 is satisfied exactly.
FIGURE 104 - DYNAMIC ODT: ODT PIN ASSERTED WITH WRITE COMMAND FOR 6 CLOCK CYCLES, BC4
T0
T1
T2
NOP
WRS4
NOP
T3
T4
T5
T6
NOP
NOP
NOP
NOP
T7
T8
T9
T10
T11
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
ODTLCNW
Address
Vali d
ODTH4
ODTL off
ODT
ODTL on
t ADC (MAX)
RTT
t ADC (MIN)
RTT_WR
t AOF (MIN)
RTT_NOM
t AON (MIN)
t ADC (MAX)
t AOF (MAX)
ODTLCWN 4
DQS, DQS#
DI
n
DQ
DI
n+1
DI
n+2
DI
n+3
WL
Transitioning
Notes:
LOGIC Devices Incorporated
Don ’t Care
1. Via MRS or OTF. AL = 0, CWL = 5. RTT_NOM and RTT_WR are enabled.
2. ODTH4 is defined from ODT registered HIGH to ODT registered LOW, so in this example,
ODTH4 is satisfied. ODT registered LOW at T5 is also legal.
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 105 - DYNAMIC ODT: ODT PIN ASSERTED WITH WRITE COMMAND FOR 4 CLOCK CYCLES, BC4
T0
T1
T2
NOP
WRS4
NOP
T3
T4
T5
T6
T7
T8
T9
T10
T11
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
ODTLCNW
Add ress
Valid
ODTL off
ODTH4
ODT
t AOF (MIN)
t ADC (MAX)
ODTL on
RTT
R_TTWR
_WR
RTT
t AON (MIN)
t AOF (MAX)
ODTLCWN 4
DQS, DQS#
WL
DI
n
DQ
DI
n+1
DI
n+2
DI
n+3
Transitioning
Notes:
1. Via MRS or OTF. AL = 0, CWL = 5. RTT_NOM can be either enabled or disabled. If disabled,
ODT can remain HIGH. RTT_WR is enabled.
2. In this example ODTH4 = 4 is satisfied exactly.
SYNCHRONOUS ODT MODE
ODT LATENCY AND POSTED ODT
6\QFKURQRXV2'7LVVHOHFWHGZKHQHYHUWKH'//LVWXUQHGRQDQGORFNHG
ZKLOH 5TT_NOM or RTTB:5 LV HQDEOHG %DVHG RQ WKH 32:(5'2:1
GHILQLWLRQWKHVHPRGHVDUH
,QV\QFKURQRXV2'7PRGH5TTWXUQVRQ2'7/RQFORFNF\FOHVDIWHU2'7
LVVDPSOHG+,*+E\DULVLQJFORFNHGJHDQGWXUQVRII2'7/RIIFORFNF\FOHV
DIWHU2'7LVUHJLVWHUHG/2:E\DULVLQJFORFNHGJH7KHDFWXDORQRIIWLPHV
YDULHVE\t$21DQGt$2)DURXQGHDFKFORFNHGJHVHH7DEOH7KH2'7
/$7(1&<LVWLHGWRWKH:5,7(/$7(1&<:/E\2'7/RQ :/DQG
2'7/RII :/
x$Q\EDQN$&7,9(ZLWK&.(+,*+
x5()5(6+PRGHZLWK&.(+,*+
x'/(PRGHZLWK&.(+,*+
x$&7,9(32:(5'2:1PRGHUHJDUGOHVVRI
05>@
x35(&+$5*(32:(5'2:1PRGHLI'//LV
HQDEOHGGXULQJ35(&+$5*(32:(5'2:1E\
MR0[12]
LOGIC Devices Incorporated
Don ’t Care
www.logicdevices.com
6LQFH:5,7(/$7(1&<LVPDGHXSRI&$6:5,7(/$7(1&<&:/DQG
$'',7,9(/$7(1&<$/WKH$/YDOXHSURJUDPPHGLQWRWKHPRGHUHJLVWHU05>@DOVRDSSOLHVWRWKH2'7VLJQDO7KH6'5$0uVLQWHUQDO2'7
VLJQDOLVGHOD\HGDQXPEHURIFORFNF\FOHVGHILQHGE\WKH$/UHODWLYHWRWKH
H[WHUQDO2'7VLJQDO7KXV2'7/RQ &:/$/yDQG2'7/RII &:/
$/y
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SYNCHRONOUS ODT TIMING PARAMETERS
6\QFKURQRXV2'7PRGHXVHVWKHIROORZLQJWLPLQJSDUDPHWHUV2'7/RQ2'7/RII2'7+2'7+ t$21DQG t$2)VHH7DEOHDQG)LJXUH7KH
PLQLPXP5TTWXUQRQWLPHt$21>0,[email protected]+,*+$DQG2'7UHVLVWDQFHEHJLQVWRWXUQRQ0D[LPXP5TTWXUQRQWLPH
t$21>0$;@LVWKHSRLQWDWZKLFK2'7UHVLVWDQFHLVIXOO\RQ%RWKDUHPHDVXUHGUHODWLYHWR2'7/RQ7KHPLQLPXP5TTWXUQRIIWLPHt$2)>[email protected]
SRLQWDWZKLFKWKHGHYLFHVWDUWVWRWXUQRII2'7UHVLVWDQFH0D[LPXP5TTWXUQRIIWLPHt$2)>0$;@LVWKHSRLQWDWZKLFK2'7KDVUHDFKHG+,*+=%RWKDUH
PHDVXUHGIURP2'7/RII
:KHQ2'7LVDVVHUWHGLWPXVWUHPDLQ+,*+XQWLO2'7+LVVDWLVILHG,ID:5,7(FRPPDQGLVUHJLVWHUHGE\WKH6'5$0ZLWK2'7+,*+WKHQ2'7PXVW
UHPDLQ+,*+XQWLO2'7+%&RU2'7+%/DIWHUWKH:5,7(FRPPDQGVHH)LJXUH2'7+DQG2'7+DUHPHDVXUHGIURP2'7UHJLVWHUHG+,*+
WR2'7UHJLVWHUHG/2:RUIURPWKHUHJLVWUDWLRQRID:5,7(FRPPDQGXQWLO2'7LVUHJLVWHUHG/2:
TABLE 73: SYNCHRONOUS ODT PARAMETERS
Symbol
Description
Begins at
Defined to
Definition for
All DDR3 bins
Units
ODTL ON
2'7V\QFKURQRXV785121GHOD\
2'7UHJLVWHUHG+,*+
RTTB21”t$21
&:/$/
t&.
ODTL OFF
2'7V\QFKURQRXV78512))GHOD\
2'7UHJLVWHUHG+,*+
RTTB2))”t$2)
&:/$/
t&.
2'7UHJLVWHUHG/2:
tcK
t&.
2'7UHJLVWHUHG+,*+RU:5,7(
2'7+
2'70LQLPXP+,*+WLPHDIWHU2'7
DVVHUWLRQRU:5,7(%&
UHJLVWUDWLRQZLWK2'7+,*+
2'7+
2'70LQLPXP+,*+WLPHDIWHU
:5,7(UHJLVWUDWLRQZLWK2'7+,*+
2'7UHJLVWHUHG/2:
6tcK
t&.
t$21
2'7785121UHODWLYHWR2'7/RQ
&RPSOHWLRQRI2'7/RQ
RTT_ON
6HH7DEOH
SV
t$2)
2'778512))UHODWLYHWR2'7/RII
&RPSOHWLRQRI2'7/RII
RTT_OFF
0.5tF.”tcK
t&.
:5,7(%/
FRPSOHWLRQ
FRPSOHWLRQ
FIGURE 106 - SYNCHRONOUS ODT
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
T10
T11
T12
CK#
CK
CKE
AL = 3
CWL -
AL = 3
ODT
ODTH4 (MIN)
ODTL off = CWL + AL - 2
ODTL on = CWL + AL - 2
t AON (MIN)
RTT
RTT_NOM
t AON (MAX)
Notes:
LOGIC Devices Incorporated
1. AL = 3; CWL = 5; ODTL on = WL = 6.0; ODTL off = WL - 2 = 6. R TT_NOM is enabled.
www.logicdevices.com
150
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 107 - SYNCHRONOUS ODT (BC4)
T0
T1
T2
NOP
NOP
NOP
T3
T4
T5
T6
T7
NOP
NOP
NOP
WRS4
T8
T9
T10
NOP
NOP
NOP
T11
T12
T13
T14
T15
T16
T17
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
CKE
Command
NOP
NOP
ODTH4 (MIN)
ODTH4
ODTH4
ODT
ODTLoff = WL - 2
ODTL off = WL - 2
ODTL on = WL - 2
ODTL on = WL - 2
t AON (MIN)
RTT
t AON (MAX)
t AOF (MIN)
t AOF (MIN)
RTT_NOM
RTT_NOM
t AOF (MAX)
t AON (MAX)
t AON (MIN)
t AOF (MAX)
Transitioning
Notes:
Don ’t Care
1.
2.
3.
4.
WL = 7. RTT_NOM is enabled. R TT_WR is disabled.
ODT must be held HIGH for at least ODTH4 after assertion (T1).
ODT must be kept HIGH ODTH4 (BC4) or ODTH8 (BL8) after the WRITE command (T7).
ODTH is measured from ODT first registered HIGH to ODT first registered LOW or from the registration of the WRITE
command with ODT HIGH to ODT registered LOW.
5. Although ODTH4 is satisfied from ODT registered HIGH at T6, ODT must not go LOW before T11 as ODTH4 must also be
satisfied from the registration of the WRITE command at T7.
ODT OFF DURING READS
$VWKH''56'5$0FDQQRWWHUPLQDWHDQGGULYHDWWKHVDPHWLPH5TTPXVWEHGLVDEOHGDWOHDVWRQHKDOIFORFNF\FOHEHIRUHWKH5($'SUHDPEOHE\GULYLQJ
WKH2'7EDOO/2:5TTPD\QRWEHHQDEOHGXQWLOWKHHQGRIWKHSRVWDPEOHDVVKRZQLQ)LJXUH
FIGURE 108 - ODT DURING READS
T0
T1
T2
T3
T4
T5
T6
Command
READ
NOP
NOP
NOP
NOP
NOP
NOP
Add ress
Vali d
T7
T8
T9
T10
T11
T12
T13
T14
T15
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
T16
T17
NOP
NOP
CK#
CK
NOP
ODTL on = CWL + AL - 2
ODTL off = CWL + AL - 2
ODT
t AOF (MIN)
RTT
RTT_NOM
RTT_NOM
t AOF (MAX)
RL = AL + CL
t AON (MAX)
DQS, DQS#
DQ
DI
b
DI
b+1
DI
b+2
DI
b+3
DI
b+4
DI
b+5
DI
b+6
DI
b+7
Transitioning
Notes:
LOGIC Devices Incorporated
Don ’t Care
1. ODT must be disabled externally during READs by driving ODT LOW. For example, CL = 6; AL = CL - 1 = 5; RL = AL +
CL = 11; CWL = 5; ODTL on = CWL + AL - 2 = 8; ODTL off = CWL + AL - 2 = 8. RTT_NOM is enabled. R TT_WR is a “Don’t Care.”
www.logicdevices.com
151
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ASYNCHRONOUS ODT MODE
$V\QFKURQRXV2'7PRGHLVDYDLODEOHZKHQWKH6'5$0UXQVLQ'//21PRGHDQGZKHQHLWKHU5TT_NOM or RTTB:5LVHQDEOHGKRZHYHUWKH'//LVWHPSRUDULO\WXUQHGRIILQ35(&+$5*('32:(5'2:1VWDQGE\YLD05>@$GGLWLRQDOO\2'7RSHUDWHVDV\QFKURQRXVO\ZKHQWKH'//LVV\QFKURQL]LQJDIWHU
EHLQJ5(6(76HHv32:(5'2:102'(wIRUGHILQLWLRQDQGJXLGDQFHRYHU32:(5'2:1GHWDLOV
,QDV\QFKURQRXV2'7WLPLQJPRGHWKHLQWHUQDO2'7FRPPDQGLVQRWGHOD\HGE\$/UHODWLYHWRWKHH[WHUQDO2'7FRPPDQG,QDV\QFKURQRXV2'7PRGH2'7
FRQWUROV5TTE\DQDORJWLPH7KHWLPLQJSDUDPHWHUVt$213'DQGt$2)3'VHH7DEOHUHSODFH2'7/RQt$21DQG2'7/RIIt$2)UHVSHFWLYHO\ZKHQ2'7
RSHUDWHVDV\QFKURQRXVO\VHH)LJXUH
7KHPLQLPXP5TTWXUQRQWLPHt$213'>0,[email protected]+,*+=DQG2'7UHVLVWDQFHEHJLQVWRWXUQRQ0D[LPXP5TTWXUQRQWLPHt$213'>0$;@LVWKHSRLQWDWZKLFK2'7UHVLVWDQFHLVIXOO\RQt$213'0,1DQGt$213'0$;DUHPHDVXUHGIURP2'7EHLQJ
VDPSOHG+,*+
7KHPLQLPXP5TTWXUQRIIWLPHt$2)3'>0,[email protected]'7UHVLVWDQFH0D[LPXP5TTWXUQRIIWLPH
t$2)3'>0$;@LVWKHSRLQWDWZKLFK2'7KDVUHDFKHG+,*+=t$2)3'0,1DQGt$2)3'0$;DUHPHDVXUHGIURP2'7EHLQJVDPSOHG/2:
FIGURE 109 - ASYNCHRONOUS ODT TIMING WITH FAST ODT TRANSITION
T0
T1
T2
T3
T4
T5
T6
T7
T8
T10
T9
T11
T12
T13
T14
T15
T16
T17
CK#
CK
CKE
t IH
t IS
t IH
t IS
ODT
t AOFPD (MIN)
t AONPD (MIN)
RTT
RTT_NOM
t AONPD (MAX)
t AOFPD (MAX)
Transitioning
Notes:
Don ’t Care
1. AL is ignored.
TABLE 74: ASYNCHRONOUS ODT TIMING PARAMETERS FOR ALL SPEED BINS
Symbol
MIN
MAX
Units
t$21
3'
$V\QFKURQRXV5TT785121GHOD\32:(5'2:1ZLWK'//RII
2
8.5
QV
t$2)
3'
$V\QFKURQRXV5TT78512))GHOD\32:(5'2:1ZLWK'//RII
2
8.5
QV
LOGIC Devices Incorporated
Description
www.logicdevices.com
152
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
SYNCHRONOUS TO ASYNCHRONOUS ODT MODE TRANSITION (POWER-DOWN ENTRY)
7KHUHLVDWUDQVLWLRQSHULRGDURXQG32:(5'2:1(175<3'(ZKHUHWKH6'5$0uV2'7PD\H[KLELWHLWKHUV\QFKURQRXVRUDV\QFKURQRXVEHKDYLRU7KLV
WUDQVLWLRQSHULRGRFFXUVLIWKH'//LVVHOHFWHGWREHRIIZKHQLQ35(&+$5*(32:(5'2:1PRGHE\WKHVHWWLQJRI05>@ 32:(5'2:1HQWU\
EHJLQVt$13'SULRUWR&.(ILUVWEHLQJUHJLVWHUHG/2:DQGLWHQGVZKHQ&/(LVILUVWUHJLVWHUHG/2:t$13'LVHTXDOWRWKHJUHDWHURI2'7/RIIt&.RU2'7/
RQt&.,ID5()5(6+FRPPDQGKDVEHHQLVVXHGDQGLWLVLQSURJUHVVZKHQ&.(JRHV/2:32:(5'2:1HQWU\ZLOOHQG t5)&DIWHUWKH5()5(6+
FRPPDQGUDWKHUWKDQZKHQ&.(LVILUVWUHJLVWHUHG/2:32:(5'2:1(175<ZLOOWKHQEHFRPHWKHJUHDWHURI t$13'DQG t5)&y5()5(6+FRPPDQG
WR&.(UHJLVWHUHG/2:
2'7DVVHUWLRQGXULQJ32:(5'2:1(175<UHVXOWVLQDQ5TTFKDQJHDVHDUO\DVWKHOHVVHURIt$213'0,1DQG2'7/RQ[t&.t$210,1RUDVODWH
DVWKHJUHDWHURIt$213'0$;DQG2'7/RQ[t&.t$210$;2'7GHDVVHUWLRQGXULQJ32:(5'2:1(175<PD\UHVXOWLQDQ5TTFKDQJHDVHDUO\
DVWKHOHVVHURI t$2)3'0,1DQG2'7/RII[ t&. t$2)0,1RUDVODWHDVWKHJUHDWHURI t$2)3'0$;DQG2'7/RII[ t&. t$2)0$;7DEOH
VXPPDUL]HVWKHVHSDUDPHWHUV
,IWKH$/KDVDODUJHYDOXHWKHXQFHUWDLQW\RIWKHVWDWHRI5TTEHFRPHVTXLWHODUJH7KLVLVEHFDXVH2'7/RQDQG2'7/RIIDUHGHULYHGIURPWKH:/DQG:/
LVHTXDOWR&:/$/)LJXUHVKRZVWKUHHGLIIHUHQWFDVHV
x2'7B$6\QFKURQRXVEHKDYLRUEHIRUHt$13'
x2'7B%2'7VWDWHFKDQJHVGXULQJWKHWUDQVLWLRQSHULRGZLWKt$213'0,1OHVVWKDQ2'7/RQ[t&.t$210,1DQGt$213'0$;
greater than ODTL on x t&.t$210$;
x2'7B&2'7VWDWHFKDQJHVDIWHUWKHWUDQVLWLRQSHULRGZLWKDV\QFKURQRXVEHKDYLRU
TABLE 75: ODT PARAMETERS FOR POWER-DOWN (DLL OFF) ENTRY AND EXIT TRANSITION PERIOD
Description
MIN
t$1
32:(5'2:1HQWU\WUDQVLWLRQ32:(5'2:1H[LW
ODT to RTT785121GHOD\2'7/RQ :/
ODT to RTT 78512))GHOD\2'7/RII :/
t$1
LOGIC Devices Incorporated
t
3' ;3'//
/HVVHURIt$13'0,1>[email protected]
/HVVHURIt$13'0,1>[email protected]
ODL on x t&.t$210,1
ODL on x t&.t$210,1
/HVVHURIt$2)3'0,1>[email protected]
/HVVHURIt$2)3'0,1>[email protected]
2'/RII[t&.t$2)0,1
2'/RII[t&.t$2)0,1
:/*UHDWHURI2'7/RIIRU2'7/RQ
3'
www.logicdevices.com
MAX
*UHDWHURIt$13' or t5)&5()5(6+WR&.(/2:
32:(5'2:1HQWU\WUDQVLWLRQSHULRG32:(5'2:1HQWU\
153
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 110 - SYNCHRONOUS TO ASYNCHRONOUS TRANSITION DURING PRECHARGE POWER-DOWN (DLL OFF) ENTRY
T0
T1
T2
T3
T4
NOP
REF
NOP
NOP
NOP
T5
T6
T7
T8
T9
T10
T11
T12
T13
Ta0
Ta1
Ta2
Ta3
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
CKE
Command
t RFC (MIN)
t ANPD
PDE transition period
ODT A
synchronous
DRAM RTT A
synchronous
t AOF (MIN)
RTT_NOM
ODTL off
ODTL off + t AOFPD (MIN)
t AOF (MAX)
t AOFPD (MAX)
ODT B
asynchronous
or synchronous
DRAM RTT B
asynchronous
or synchronous
t AOFPD (MIN)
RTT_NOM
ODTL off + t AOFPD (MAX)
ODT C
asynchronous
t AOFPD (MIN)
DRAM RTT C
asynchronous
RTT_NOM
t AOFPD (MAX)
Indicates a Break In
Time Scale
Notes:
Transitioning
Don ’t Care
1. AL = 0; CWL = 5; ODTL off = WL - 2 = 3.
ASYNCHRONOUS TO SYNCHRONOUS ODT MODE TRANSITION (POWER-DOWN EXIT)
7KH6'5$0uV2'7PD\H[KLELWHLWKHUDV\QFKURQRXVRUV\QFKURQRXVEHKDYLRUGXULQJ32:(5'2:1(;,73';7KLVWUDQVLWLRQSHULRGRFFXUVLIWKH'//LV
VHOHFWHGWREHRIIZKHQLQ35(&+$5*(32:(5'2:1PRGHE\VHWWLQJ05>@WRvw32:(5'2:1H[LWEHJLQVt$13'SULRUWR&.(ILUVWEHLQJUHJLVWHUHG+,*+DQGLWHQGVt;3'//DIWHU&.(LVILUVWUHJLVWHUHG+,*+t$13'LVHTXDOWRWKHJUHDWHURI2'7/RIIt&.RU2'7/RQt&.7KHWUDQVLWLRQSHULRG
LVt$13'SOXVt;3'//
2'7DVVHUWLRQGXULQJ32:(5'2:1H[LWUHVXOWVLQDQ5TTFKDQJHDVHDUO\DVWKHOHVVHURI t$213'0,1DQG2'7/RQ[ t&.t$210,1RUDVODWHDV
WKHJUHDWHURIt$213'0$;DQG2'7/RQ[t&.t$210$;2'7GHDVVHUWLRQGXULQJ32:(5'2:1(;,7PD\UHVXOWLQDQ5TTFKDQJHDVHDUO\DVWKH
OHVVHURIt$2)3'0,1DQG2)7/RII[t&.t$2)0,1RUDVODWHDVWKHJUHDWHURIt$2)3'0$;DQG2'7/RII[t&.t$2)0$;7DEOHVXPPDUL]HV
WKHVHSDUDPHWHUV
,IWKH$/KDVDODUJHYDOXHWKHXQFHUWDLQW\RIWKH5TTVWDWHEHFRPHVTXLWHODUJH7KLVLVEHFDXVH2'7/RQDQG2'7/RIIDUHGHULYHGIURPWKH:/DQGWKH:/
LVHTXDOWR&:/$/)LJXUHVKRZVWKUHHGLIIHUHQWFDVHV
x2'7&$V\QFKURQRXVEHKDYLRUEHIRUHt$13'
x2'7%2'7VWDWHFKDQJHVGXULQJWKHWUDQVLWLRQSHULRGZLWKt$2)3'0,1OHVVWKDQ2'7/RII[t&.t$2)0,1DQG2'7/RII[t&.
t$2)0$;JUHDWHUWKDQt$2)3'0$;
x2'7$2'7VWDWHFKDQJHVDIWHUWKHWUDQVLWLRQSHULRGZLWKV\QFKURQRXVUHVSRQVH
LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
LOGIC Devices Incorporated
www.logicdevices.com
155
DRAM RTT C
synchronous
ODT C
synchronous
ODT B
asynchronous
or synchronous
RTT B
asynchronous
or synchronous
DRAM RTT A
asynchronous
ODT A
asynchronous
COMMAND
CKE
CK#
CK
T0
RTT_NOM
T1
t ANPD
RTT_NOM
t AOFPD (MAX)
t AOFPD (MIN)
T2
Ta0
NOP
Ta1
Notes:
NOP
Ta2
NOP
Ta4
NOP
Ta5
t XPDLL
NOP
Ta 6
NOP
T b0
NOP
Tb1
NOP
Tb2
NOP
Tc0
NOP
Tc1
Indicates A Break in
Time Scale
1. CL = 6; AL = CL - 1; CWL = 5; ODTL off = WL - 2 = 8.
RTT_NOM
ODTL off + t AOF (MAX)
t AOFPD (MAX)
ODTL off + t AOF (MIN)
PDX transition period
t AOFPD (MIN)
NOP
Ta3
Transitioning
ODTL off
NOP
Tc2
NOP
Td1
Don ’t Care
t AOF (MIN)
t AOF (MAX)
NOP
Td0
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
FIGURE 111 - ASYNCHRONOUS TO SYNCHRONOUS TRANSITION DURING PRECHARGE POWER-DOWN (DLL OFF) EXIT
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
ASYNCHRONOUS TO SYNCHRONOUS ODT MODE TRANSITION (SHORT CKE PULSE)
,IWKHWLPHLQWKH35(&+$5*(32:(5'2:1RU,'/(VWDWHVLVYHU\VKRUWVKRUW&.(/2:SXOHVWKH32:(5'2:1(175<DQG32:(5'2:1(;,7
WUDQVLWLRQSHULRGVZLOORYHUODS:KHQRYHUODSRFFXUVWKHUHVSRQVHRIWKH6'5$0uV5TTWRDFKDQJHLQWKH2'7VWDWHPD\EHV\QFKURQRXVRUDV\QFKURQRXV
IURPWKHVWDUWRIWKH32:(5'2:1(175<WUDQVLWLRQSHULRGWRWKHHQGRIWKH32:(5'2:1(;,7WUDQVLWLRQSHULRGHYHQLIWKH(175<SHULRGHQGVODWHU
WKDQWKH(;,7SHULRGVHH)LJXUH
,IWKHWLPHLQWKHLGOHVWDWHLVYHU\VKRUWVKRUW&.(+,*+SXOVHWKH32:(5'2:1(;,7DQG32:(5'2:1(175<WUDQVLWLRQSHULRGVRYHUODS:KHQWKLV
RYHUODSRFFXUVWKHUHVSRQVHRIWKH6'5$0uV5TTWRDFKDQJHLQWKH2'7VWDWHPD\EHV\QFKURQRXVRUDV\QFKURQRXVIURPWKHVWDUWRIWKH32:(5'2:1
(;,7WUDQVLWLRQSHULRGWRWKHHQGRIWKH32:(5'2:1(175<WUDQVLWLRQSHULRGVHH)LJXUH
FIGURE 112 - TRANSITION PERIOD FOR SHORT CKE LOW CYCLES WITH ENTRY AND EXIT PERIOD OVERLAPPING
T0
T1
T2
T3
T4
T5
T6
T7
T8
T9
Ta0
Ta1
Ta2
Ta3
Ta4
REF
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
CKE
PDE transition period
t ANPD
t RFC(MIN)
PDX transition perio d
t XPDLL
t ANPD
Short CKE LOW transition period (RTT chan ge asynchronous or syn chronous)
Indicates a Break in
Time Scale
Notes:
Transitionin g
Don ’t Care
1. AL = 0, WL = 5, t ANPD = 4.
FIGURE 113 - TRANSITION PERIOD FOR SHORT CKE HIGH CYCLES WITH ENTRY AND EXIT PERIOD OVERLAPPING
T0
T1
T2
T3
T4
T5
T6
NOP
NOP
N
NOP
OP
NOP
NOP
NOP
NOP
T7
T8
T9
NOP
NOP
NOP
Ta0
Ta1
Ta2
Ta3
Ta4
NOP
NOP
NOP
NOP
NOP
CK#
CK
Command
CKE
t ANPD
t XPDLL
t ANPD
Short CKE HIGH transition period (R TT chan ge asynchronous or synchonous)
Indicates A Break in
Time Scale
Notes:
LOGIC Devices Incorporated
www.logicdevices.com
Transitionin g
Don ’t Care
1. AL = 0, WL = 5, t ANPD = 4.
156
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
List of Figures
)LJXUH*E''53DUW1XPEHUV )LJXUH6LPSOLILHG6WDWH'LDJUDP )LJXUH$/'0'%*)XQFWLRQDO%ORFN'LDJUDP
)LJXUH%/'0'%*)XQFWLRQDO%ORFN'LDJUDP
)LJXUH3LQRXW7RS9LHZ )LJXUH0HFKDQLFDO'UDZLQJ
)LJXUH,QSXW6LJQDO )LJXUH2YHUVKRRW6SHFLILFDWLRQV
)LJXUH8QGHUVKRRW6SHFLILFDWLRQV )LJXUH9,;IRU'LIIHUHQWLDO6LJQDOV )LJXUH6LQJOH(QGHG5HTXLUHPHQWVIRU'LIIHUHQWLDO6LJQDOV )LJXUH'HILQLWLRQRI'LIIHUHQWLDO$&6ZLQJDQGt'9$&
)LJXUH1RPLQDO6OHZ5DWH'HILQLWLRQIRU6LQJOH(QGHG,QSXW6LJQDOV )LJXUH1RPLQDO'LIIHUHQWLDO,QSXW6OHZ5DWH'HILQLWLRQIRU'46'46DQG&.&.
)LJXUH2'7/HYHOVDQG,9&KDUDFWHULVWLFV )LJXUH2'77LPLQJ5HIHUHQFH/RDG
Figure 16: t$21DQGt$2)'HILQLWLRQV )LJXUHt$213'DQGt$2)3''HILQLWLRQ
Figure 18: t$'&'HILQLWLRQ
)LJXUH2XWSXW'ULYHU
)LJXUH'42XWSXW6LJQDO )LJXUH'LIIHUHQWLDO2XWSXW6LJQDO
)LJXUH5HIHUHQFH2XWSXW/RDGIRU$&7LPLQJDQG2XWSXW6OHZ5DWH )LJXUH1RPLQDO6OHZ5DWH'HILQLWLRQIRU6LQJOH(QGHG2XWSXW6LJQDOV
)LJXUH1RPLQDO'LIIHUHQWLDO2XWSXW6OHZ5DWH'HILQLWLRQIRU'46'46
)LJXUH1RPLQDO6OHZ5DWHDQGt9$&IRUt,6&RPPDQGDQG$GGUHVV&ORFN
)LJXUH1RPLQDO6OHZ5DWHIRUt,+&RPPDQGDQG$GGUHVV&ORFN )LJXUH7DQJHQW/LQHIRUt,6&RPPDQGDQG$GGUHVV&ORFN
)LJXUH7DQJHQW/LQHIRUt,+&RPPDQGDQG$GGUHVV&ORFN
)LJXUH1RPLQDO6OHZ5DWHDQGt9$&IRUt'6'46WUREH )LJXUH1RPLQDO6OHZ5DWHIRUt'+'46WUREH
)LJXUH1RPLQDO6OHZ5DWHDQGt9$&IRUt'6'46WUREH )LJXUH1RPLQDO6OHZ5DWHIRUt'+'46WUREH
)LJXUH5HIUHVK0RGH
)LJXUH'//(QDEOH0RGHWR'//'LVDEOH0RGH
)LJXUH'//'LVDEOH0RGHWR'//(QDEOH0RGH
)LJXUH'//'LVDEOHt'46&.7LPLQJ
)LJXUH&KDQJH)UHTXHQF\'XULQJ3UHFKDUJH3RZHU'RZQ )LJXUH:ULWH/HYHOLQJ&RQFHSW
)LJXUH:ULWH/HYHOLQJ6HTXHQFH
)LJXUH([LW:ULWH/HYHOLQJ )LJXUH,QLWLDOL]DWLRQ6HTXHQFH
)LJXUH056WR056&RPPDQGWLPLQJ
)LJXUH056WRQRQ056&RPPDQG7LPLQJt02' )LJXUH0RGH5HJLVWHU05'HILQLWLRQV )LJXUH5($'/DWHQF\
)LJXUH0RGH5HJLVWHU05'HILQLWLRQ LOGIC Devices Incorporated
www.logicdevices.com
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
)LJXUH5($'/DWHQF\$/ &/ )LJXUH0RGH5HJLVWHU05'HILQLWLRQ )LJXUH&$6:ULWH/DWHQF\ )LJXUH0RGH5HJLVWHU05'HILQLWLRQ )LJXUH0XOWLSXUSRVH5HJLVWHU035%ORFN'LDJUDP )LJXUH0356\VWHP5HDG&DOLEUDWLRQZLWK%/)L[HG%XUVW2UGHU6LQJOH5HDGRXW )LJXUH0356\VWHP5HDG&DOLEUDWLRQZLWK%/)L[HG%XUVW2UGHU%DFNWR%DFN5HDGRXW
)LJXUH0356\VWHP5HDG&DOLEUDWLRQZLWK%&/RZHU1LEEOHWKHQ8SSHU1LEEOH )LJXUH0356\VWHP5HDG&DOLEUDWLRQZLWK%&8SSHU1LEEOHWKHQ/RZHU1LEEOH )LJXUH=4&DOLEUDWLRQ7LPLQJ=4&/DQG=4&6
)LJXUH([DPSOH0HHWLQJt55'0,1DQGt5&'0,1
)LJXUH([DPSOHt)$:
)LJXUH5($'/DWHQF\
)LJXUH&RQVHFXWLYH5($'%XUVWV%/
)LJXUH&RQVHFXWLYH5($'%XUVWV%&
)LJXUH1RQFRQVHFXWLYH5($'%XUVWV
)LJXUH5($'%/WR:5,7(%/
)LJXUH5($'%&WR:5,7(%&27) )LJXUH5($'WR35(&+$5*(%/
)LJXUH5($'WR35(&+$5*(%&
)LJXUH5($'WR35(&+$5*($/ &/ )LJXUH5($'ZLWK$XWR3UHFKDUJH$/ &/ )LJXUH'DWD2XWSXW7LPLQJt'464DQG'DWD9DOLG:LQGRZ )LJXUH'DWD6WUREH7LPLQJ5($'V
)LJXUH0HWKRGIRU&DOFXODWLQJt/=DQGt+= )LJXUHt535(7LPLQJ
)LJXUHt53677LPLQJ
)LJXUHt:35(7LPLQJ
)LJXUHt:3677LPLQJ
)LJXUH:ULWH%XUVW )LJXUH&RQVHFXWLYH:5,7(%/WR:5,7(%/ )LJXUH&RQVHFXWLYH:5,7(%&WR:5,7(%&YLD056RU27) )LJXUH1RQFRQVHFXWLYH:5,7(WR:5,7( )LJXUH:5,7(%/WR5($'%/
)LJXUH:5,7(WR5($'%&0RGH5HJLVWHU6HWWLQJ
)LJXUH:5,7(%&27)WR5($'%&27)
)LJXUH:5,7(%/WR35(&+$5*(
)LJXUH:5,7(%&0RGH5HJLVWHU6HWWLQJWR35(&+$5*(
)LJXUH:5,7(%&27)WR35(&+$5*( )LJXUH'DWD,QSXW7LPLQJ )LJXUH6HOI5HIUHVK(QWU\([LW7LPLQJ
)LJXUH$FWLYH3RZHU'RZQ(QWU\DQG([LW )LJXUH3UHFKDUJH3RZHU'RZQ)DVW([LW0RGH(QWU\DQG([LW
)LJXUH3UHFKDUJH3RZHU'RZQ6ORZ([LW0RGH(QWU\DQG([LW
)LJXUH3RZHU'RZQ(QWU\$IWHU5($'RU5($'ZLWK$XWR3UHFKDUJH5'$3
)LJXUH3RZHU'RZQ(QWU\$IWHU:5,7(
)LJXUH3RZHU'RZQ(QWU\$IWHU:5,7(ZLWK$XWR3UHFKDUJH:5$3
)LJXUH5()5(6+WR3RZHU'RZQ(QWU\
)LJXUH$&7,9$7(WR3RZHU'RZQ(QWU\
)LJXUH35(&+$5*(WR3RZHU'RZQ(QWU\ LOGIC Devices Incorporated
www.logicdevices.com
158
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
)LJXUH056&RPPDQGWR3RZHU'RZQ(QWU\
)LJXUH3RZHU'RZQ([LWWR5HIUHVKWR3RZHU'RZQ(QWU\ )LJXUH5(6(76HTXHQFH )LJXUH2Q'LH7HUPLQDWLRQ
)LJXUH'\QDPLF2'72'7$VVHUWHG%HIRUHDQG$IWHUWKH:5,7(%& )LJXUH'\QDPLF2'7:LWKRXW:5,7(&RPPDQG )LJXUH'\QDPLF2'72'73LQ$VVHUWHG7RJHWKHUZLWK:5,7(&RPPDQGIRU&ORFN&\FOHV%/ )LJXUH'\QDPLF2'72'73LQ$VVHUWHGZLWK:5,7(&RPPDQGIRU&ORFN&\FOHV%& )LJXUH'\QDPLF2'72'73LQ$VVHUWHGZLWK:5,7(&RPPDQGIRU&ORFN&\FOHV%& )LJXUH6\QFKURQRXV2'7 )LJXUH6\QFKURQRXV2'7%& )LJXUH2'7'XULQJ5($'V
)LJXUH$V\QFKURQRXV2'77LPLQJZLWK)DVW2'77UDQVLWLRQ
)LJXUH6\QFKURQRXVWR$V\QFKURQRXV7UDQVLWLRQGXULQJ3UHFKDUJH3RZHU'RZQ'//2II(QWU\
)LJXUH$V\QFKURQRXVWR6\QFKURQRXV7UDQVLWLRQGXULQJ3UHFKDUJH3RZHU'RZQ'//2II([LW
)LJXUH7UDQVLWLRQ3HULRGIRU6KRUW&.(/2:&\FOHVZLWK(QWU\DQG([LW3HULRG2YHUODSSLQJ
)LJXUH7UDQVLWLRQ3HULRGIRU6KRUW&.(+,*+&\FOHVZLWK(QWU\DQG([LW3HULRG2YHUODSSLQJ
LOGIC Devices Incorporated
www.logicdevices.com
159
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
List of Tables
7DEOH$GGUHVVLQJ 7DEOH%DOO6LJQDO/RFDWLRQDQG'HVFULSWLRQ 7DEOH$EVROXWH0D[LPXP5DWLQJV 7DEOH,QSXW2XWSXW&DSDFLWDQFH
7DEOH7LPLQJ3DUDPHWHUVIRU,''0HDVXUHPHQWV&ORFN8QLWV
7DEOH,DD00HDVXUHPHQW/RRS
7DEOH,DD10HDVXUHPHQW/RRS
7DEOH,DD0HDVXUHPHQW&RQGLWLRQVIRU3RZHU'RZQ&XUUHQWV 7DEOH,DD2N,DD3N0HDVXUHPHQW/RRS 7DEOH,DD2NT0HDVXUHPHQW/RRS
7DEOH,''50HDVXUHPHQW/RRS
7DEOH,'':0HDVXUHPHQW/RRS
7DEOH,DD5B0HDVXUHPHQW/RRS
7DEOH,DD 0HDVXUHPHQW/RRS
7DEOH,'' 0HDVXUHPHQW/RRS
7DEOH,DD0D[LPXP/LPLWV 7DEOH'&(OHFWULFDO&KDUDFWHULVWLFVDQG2SHUDWLQJ&RQGLWLRQV
7DEOH'&(OHFWULFDO&KDUDFWHULVWLFVDQG,QSXW&RQGLWLRQV
7DEOH,QSXW6ZLWFKLQJ&RQGLWLRQV 7DEOH&RQWURODQG$GGUHVV3LQV
7DEOH&ORFN'DWD6WUREHDQG0DVN3LQV 7DEOH'LIIHUHQWLDO,QSXW2SHUDWLQJ&RQGLWLRQV&.[&.[?'46[DQG'46[?
7DEOH'LIIHUHQWLDO,QSXW2SHUDWLQJFRQGLWLRQVt'9$&IRU&.[&.[?'46[DQG'46[?
7DEOH6LQJOH(QGHG,QSXW6OHZ5DWH
7DEOH'LIIHUHQWLDO,QSXW6OHZ5DWH'HILQLWLRQ
7DEOH2Q'LH7HUPLQDWLRQ'&(OHFWULFDO&KDUDFWHULVWLFV
7DEOH5TT(IIHFWLYH,PSHGDQFHV
7DEOH2'76HQVLWLYLW\'HILQLWLRQ
7DEOH2'77HPSHUDWXUH9ROWDJH6HQVLWLYLW\
7DEOH2'77LPLQJ'HILQLWLRQV
7DEOH5HIHUHQFH6HWWLQJVIRU2'77LPLQJ0HDVXUHPHQWV 7DEOH:'ULYHU,PSHGDQFH&KDUDFWHULVWLFV
7DEOH:'ULYHU3XOO8SDQG3XOO'RZQ,PSHGDQFH&DOFXODWLRQV 7DEOH:'ULYHU,2+,OL&KDUDFWHULVWLFV9DD 9DDQ 9
7DEOH:'ULYHU,2+,OL&KDUDFWHULVWLFV9DD 9DDQ 9
7DEOH:'ULYHU,2+,OL&KDUDFWHULVWLFV9DD 9DDQ 9
7DEOH:2XWSXW'ULYHU6HQVLWLYLW\'HILQLWLRQ
7DEOH:2XWSXW'ULYHU9ROWDJHDQG7HPSHUDWXUH6HQVLWLYLW\
7DEOH:'ULYHU,PSHGDQFH&KDUDFWHULVWLFV
7DEOH:2XWSXW'ULYHU6HQVLWLYLW\'HILQLWLRQ
7DEOH:2XWSXW'ULYHU9ROWDJHDQG7HPSHUDWXUH6HQVLWLYLW\
7DEOH6LQJOH(QGHG2XWSXW'ULYHU&KDUDFWHULVWLFV 7DEOH'LIIHUHQWLDO2XWSXW'ULYHU&KDUDFWHULVWLFV
7DEOH6LQJOH(QGHG2XWSXW6OHZ5DWH
7DEOH'LIIHUHQWLDO2XWSXW6OHZ5DWH'HILQLWLRQ
7DEOH6SHHG%LQV 7DEOH(OHFWULFDO&KDUDFWHULVWLFVDQG$&2SHUDWLQJ&RQGLWLRQV
7DEOH&RPPDQGDQG$GGUHVV6HWXSDQG+ROG9DOXHV5HIHUHQFHGDW9QV$&'&%DVHG
LOGIC Devices Incorporated
www.logicdevices.com
160
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
7DEOH'HUDWLQJ9DOXHVIRUW,6W,+$&'&%DVHG
7DEOH'HUDWLQJ9DOXHVIRUW,6W,+$&'&%DVHG
7DEOH0LQLPXP5HTXLUHG7LPHt9$&DERYH9,+$&IRUD9DOLG7UDQVLWLRQ
7DEOH'DWD6HWXSDQG+ROG9DOXHVDW9QV'46['46[?DW9QV$&'&%DVHG
7DEOH'HUDWLQJ9DOXHIRUW'6W'+$&'&%DVHG 7DEOH'HUDWLQJ9DOXHIRUW'6W'+$&'&%DVHG 7DEOH5HTXLUHG7LPHt9$&DERYH9,+$&%HORZ9,/>$&@IRUD9DOLG7UDQVLWLRQ 7DEOH7UXWK7DEOH&RPPDQG
7DEOH7UXWK7DEOH&.( 7DEOH5HDG&RPPDQG6XPPDU\ 7DEOH:ULWH&RPPDQG6XPPDU\ 7DEOH%XUVW2UGHU 7DEOH%XUVW2UGHU 7DEOH%XUVW2UGHU 7DEOH6(/)5()5(6+7HPSHUDWXUHDQG$8726(/)5()5(6+'HVFULSWLRQ
7DEOH6(/)5()5(6+0RGH6XPPDU\
7DEOH&200$1'WR32:(5'2:1(QWU\3DUDPHWHUV
7DEOH32:(5'2:10RGHV
7DEOH32:(5'2:10RGHV
7DEOH2'73DUDPHWHU
7DEOH'<1$0,&2'76SHFLILF3DUDPHWHUV 7DEOH02'(5(*,67(56IRU5TT_NOM
7DEOH02'(5(*,67(56IRU577B:5
7DEOH7,0,1*',$*5$06IRU'<1$0&2'7
7DEOH6<1&+5212862'73DUDPHWHUV 7DEOH$6<1&+5212862'77LPLQJ3DUDPHWHUVIRUDOO6SHHG%LQV
7DEOH2'73DUDPHWHUVIRU32:(5'2:1'//2II(QWU\DQG([LW7UDQVLWLRQ3HULRG
LOGIC Devices Incorporated
www.logicdevices.com
161
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2
PRELIMINARY INFORMATION
L9D3256M32DBG2
L9D3512M32DBG2
16-32 Gb, DDR3, 256-512M x 32 Dual Channel Memory Module
REVISION HISTORY
Revision
Engineer
Issue Date
Description Of Change
$
.+/
01.31.2012
,1,7,$7(
B
.+/
03.21.2012
&RUUHFWHGWKH,QGXVWULDORSHUDWLQJWHPSHUDWXUHUDQJHLQ7DEOH$EVROXWH0D[LPXP5DWLQJV
&
.+/
06.12.2012
3DUW1XPEHU&KDQJH8SGDWHG%ORFNDQG3LQRXW'LDJUDPV$GGHG/LVWRI7DEOHVDQG)LJXUHV
D
.+/
03.06.2013
8SGDWHG%ORFNDQG3LQRXW'LDJUDPV
/2*,&'HYLFHV,QFRUSRUDWHGUHVHUYHVWKHULJKWWRPDNHFRUUHFWLRQVPRGLILFDWLRQVHQKDQFHPHQWVLPSURYHPHQWVDQGRWKHUFKDQJHVWRLWV
SURGXFWVDQGVHUYLFHVDWDQ\WLPHDQGWRGLVFRQWLQXHDQ\SURGXFWRUVHUYLFHZLWKRXWQRWLFH&XVWRPHUVVKRXOGREWDLQWKHODWHVWUHOHYDQWLQIRUPDWLRQEHIRUHSODFLQJRUGHUVDQGVKRXOGYHULI\WKDWVXFKLQIRUPDWLRQLVFXUUHQWDQGFRPSOHWH/2*,&'HYLFHVGRHVQRWDVVXPHDQ\OLDELOLW\DULVLQJ
RXWRIWKHDSSOLFDWLRQRUXVHRIDQ\SURGXFWRUFLUFXLWGHVFULEHGKHUHLQ,QQRHYHQWVKDOODQ\OLDELOLW\H[FHHGWKHSURGXFWSXUFKDVHSULFH/2*,&
'HYLFHVEHOLHYHVWKHLQIRUPDWLRQFRQWDLQHGKHUHLQLVDFFXUDWHKRZHYHULWLVQRWOLDEOHIRULQDGYHUWHQWHUURUV,QIRUPDWLRQVXEMHFWWRFKDQJHZLWKRXW
QRWLFH/2*,&'HYLFHVDVVXPHVQROLDELOLW\IRUXVHRILWVSURGXFWVLQPLVVLRQFULWLFDORUOLIHVXSSRUWDSSOLFDWLRQV3URGXFWVRI/2*,&'HYLFHVDUHQRW
ZDUUDQWHGQRULQWHQGHGWREHXVHGIRUPHGLFDOOLIHVXSSRUWOLIHVDYLQJFULWLFDOFRQWURORUVDIHW\DSSOLFDWLRQVXQOHVVSXUVXDQWWRDQH[SUHVVZULWWHQ
DJUHHPHQWZLWK/2*,&'HYLFHV)XUWKHUPRUH/2*,&'HYLFHVGRHVQRWDXWKRUL]HLWVSURGXFWVIRUXVHDVFULWLFDOFRPSRQHQWVLQOLIHVXSSRUWV\VWHPV
ZKHUHDPDOIXQFWLRQRUIDLOXUHPD\UHDVRQDEO\EHH[SHFWHGWRUHVXOWLQVLJQLILFDQWLQMXU\WRWKHXVHU
LOGIC Devices Incorporated
www.logicdevices.com
162
High Performance, Integrated Memory Module Product
March 6, 2013 LDS-L9D3xxxM32DBG2